KEGG   Serpula lacrymans: SERLADRAFT_455388Help
Entry
SERLADRAFT_455388 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
sla  Serpula lacrymans
Pathway
sla00020  Citrate cycle (TCA cycle)
sla00640  Propanoate metabolism
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
sla01130  Biosynthesis of antibiotics
sla01200  Carbon metabolism
Module
sla_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sla_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SERLADRAFT_455388
   00640 Propanoate metabolism
    SERLADRAFT_455388
Enzymes [BR:sla01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     SERLADRAFT_455388
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SERLADRAFT_455388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 GFO_IDH_MocA NTPase_1
Motif
Other DBs
NCBI-GeneID: 18817164
NCBI-ProteinID: XP_007312845
JGI: 455388
UniProt: F8NFZ1
Position
Unknown
AA seq 331 aa AA seqDB search
MFRRAGQSLVTSTGRRSFTQSAARKSYADTAKNLLIHKDTKVLCQGFTGKTATFHAKEAL
AYGTKMVGGVSPKKAGEMHLGLPVFGTVREAVRETQPDATVLYVPPPTAADAIIEAIENE
IGLIVCITEGIPQSDEIRVMNALKSQSKSRLVGPNCPGIINPLGCKIGIQPGHIHKPGKI
GIVSRSGTLTYEAVAQTTDIGLGQSLCVGIGGDPFPGTQHIDVIRIFLEDDNTEGIVIIG
EIGGSMEEEAAEYLEKYNKTRSKPKPVVGFIAGRTAPPGRRMGHAGAIISGGKGAASDKI
AALERAGAFVTDSPAKIGVQMLKAMQAAGLV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgtcgcgctggacaatcactggtgactagcaccggtcgtcggtcttttactcag
tctgctgctcgaaagagctatgctgacaccgcaaagaaccttctcatccacaaagacaca
aaagtcctctgtcaaggattcacgggaaagacggctaccttccatgcaaaagaagcgttg
gcatatggcacgaagatggttggaggtgtctctcctaagaaagctggagaaatgcacctt
ggtcttcccgtttttggtacagtgagagaggctgtaagggagacgcaacccgacgccact
gttctctatgtccctccacccacagcagccgacgccattatcgaggcgattgaaaacgaa
attggtctcatagtctgcataacagaaggcattccccagtctgatgagattagggttatg
aacgctctgaagagccagtccaaatcccgtcttgttggaccaaactgtcctggtatcatc
aatcctctaggttgcaagattggtatccaaccgggtcatatccacaaacctggcaaaatc
ggtattgtatcccgctctggcacactgacatacgaggccgtggcacagaccacagatatt
ggattgggacagtccctttgtgtcggtatcggaggtgatcctttccctggcacacaacac
atcgatgttattcgtatcttccttgaggacgacaacacagaaggtattgtcattattggc
gaaattggtggctcgatggaagaggaagctgccgagtacttggaaaagtacaacaagaca
cgcagcaaacccaaacctgttgtgggctttattgctggacgcactgcaccacctggcaga
cgtatggggcacgctggtgctatcatatctggaggaaaaggagctgcatcagataagatc
gctgctttagagagggctggtgcatttgtgactgatagtcctgctaagattggtgttcaa
atgctcaaggcaatgcaagctgctggtctcgtatag

DBGET integrated database retrieval system