KEGG   Serpula lacrymans: SERLADRAFT_471802Help
Entry
SERLADRAFT_471802 CDS       T03135                                 

Definition
(RefSeq) hypothetical protein
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
sla  Serpula lacrymans
Pathway
sla00220  Arginine biosynthesis
sla01100  Metabolic pathways
sla01110  Biosynthesis of secondary metabolites
sla01130  Biosynthesis of antibiotics
sla01230  Biosynthesis of amino acids
Module
sla_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:sla00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    SERLADRAFT_471802
Enzymes [BR:sla01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     SERLADRAFT_471802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-GeneID: 18820025
NCBI-ProteinID: XP_007320332
JGI: 471802
UniProt: F8P1R3
Position
Unknown
AA seq 356 aa AA seqDB search
MAVVPHLKTLADLTAPQISRIVSHAHYLKQVSLPWLEPQRAGKKGSRQGLRMPSQSLFNK
SIALIFSKRSTRTRVSAETASVLLGGRSLFLGRDDIQLGENETLRDTARVIGGMCQGIFA
RVGEHEEIEELAKYSPVPVVNALSSLWHPTQTLADMLTLHEHAHLFESDPTAAPAANKPL
AAVRPLTIAWVGDSCNVLHDMLVTYPRLGHKMRVATPPQAMYQCPPAVWDRVTQLGCDKG
IHWTNNPLEAVHGADVVVTDTWISMGQEAEKEQRLRDFAGYQVTEKLCREGGANPNWKFM
HCLPRKKNEVDDEVMYGPRSLVFPEADNRKWSMMAIFDLYFGKWDITGEKALNEVD
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggccgttgttcctcatttgaagacgttggcagacctcacagcaccccaaatatctcgc
attgtcagtcatgcacactacctcaagcaagtctctctcccttggcttgagccccagagg
gctggcaaaaagggcagccgtcaaggtcttcggatgccttcgcagtccctgttcaacaag
tctatagcactcatcttctcaaagcgaagcacccgtactcgggtttctgctgaaaccgcc
tccgtccttcttggtggacgttctctgtttctcggtcgcgacgacattcagcttggcgag
aacgagaccctcagagatacggctcgcgtcatcggcggtatgtgtcaagggatattcgcc
cgagttggagaacacgaggagatcgaggaattagcaaagtattcacccgtcccagttgtc
aacgcactttcttccctttggcatcccactcagacgttggcggatatgttgaccttacat
gaacatgcccacctattcgaatcggaccctacggcagcgccagctgccaacaagcccttg
gccgcagtgcgtccattgaccatagcttgggttggagactcttgcaacgtcctgcacgat
atgcttgttacatatcctcgactaggacacaaaatgcgagtagcgacacctccacaggca
atgtaccagtgtcctccagcggtctgggaccgcgtaacgcaattggggtgcgacaaaggt
atccactggacaaacaatcctctcgaagctgttcatggagcagatgttgtagtcaccgat
acatggatctccatgggccaagaagcggaaaaggagcaacgtctcagggattttgcaggc
tatcaagtcactgaaaaactctgtcgcgaaggtggagctaatcccaactggaagtttatg
cattgcctccctcggaaaaagaatgaagtagatgatgaggttatgtatgggcctcgatcg
cttgtcttccccgaagcagataaccgaaaatggtccatgatggctatctttgatctttac
tttggtaaatgggatatcacaggcgaaaaggcattgaacgaagtcgattaa

DBGET integrated database retrieval system