KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111644633
Entry
111644633         CDS       T06058                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1-like
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slal01002]
    111644633
Enzymes [BR:slal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     111644633
Peptidases and inhibitors [BR:slal01002]
 Metallo peptidases
  Family M1
   111644633
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 111644633
NCBI-ProteinID: XP_023249332
Position
Unknown
AA seq 940 aa
MFVAPLLLLLFGPFAPSSGAQLPNEGQAKDPPIATNGQPFPWDRMRLPKTVSPIHYDLII
HPNLTTFDFTGVARIELDVHEDTSVIVLHAKQMQISNVLLLAPEGVRPLRVLEYPRFHQL
ALLSDSVLTKGRKYEVQLGFAANLSDSYHGFYKSSYRTSAGEVRFMASTQFEATFARGAF
PCFDEPAFKANFTIRITREPRHIAISNMPKVKTVALPGGLLEDHFDTTVKMSTYLVAYIV
SDFLSVSKTTQHGVKISIYAVPEKIDQTAFALDAAVKLLDFYDDYFDIPYPLPKQDLAAI
PDFQSGAMENWGLTTYRETGLLFDADRSSASDKLGITKVIAHELAHQWFGNLVTMEWWND
LWLNEGFAKFMEYISLDITYPELHVDDFFLGKCFEAMEVDSLSSSHPVSTPVENPMQIQE
MFDDVSYDKGACILNMLRDFLTPEAFEIGIIQYLKRYSYQNTVNSHLWESLTNICDSDDL
DEGRMKHKEFCSKRNVPSGASKWYSDDELDVRAIMDTWTLQEGFPLVTVEVRGREVRLSQ
ERYLKTDDPSLTEGFLWQIPLTYMTSASSTIHRFLLKTKTDVLYLPEEVDWVKFNVDMSG
YYMVHYAGNGWNSIIRLLQHNHMALTSNDRASLIHNVFQLVSIGKVRLDTALELSLYLSR
ETEIMAVTQGFGELVPLYKLMEKRDMPALENQMKGYIVDLFRGLIDRQEWSDSGSVSERV
LRSYLLLFACVRNYTPCVTKATQLFNQWKASDGKISLPVDITMAVFVIGARTPEGWNFLF
EKYRNAMQMSVKSRMKTAMTVTPLQDKLKWMMEQSLRGDVMKTQDLPDVVVSVSKNPHGF
KLAWDFLRANWHTLIKKFDLGSSTISYMVTGVTNQYSTRETLNEVRSFFGSLTEETGSEM
RCIQQTYETIEDNIRWMDTNLPLLRAWLDKHGHKGPHEDL
NT seq 2823 nt   +upstreamnt  +downstreamnt
atgtttgtggctcctctcctgctgctgctattcggtcccttcgctccctcatctggagcg
cagctgccaaatgaaggccaagccaaagacccccccatagctaccaacggccagccattc
ccctgggatcgcatgcgacttcccaaaaccgtctcccccatccactacgacctgatcatc
caccccaacctgaccaccttcgacttcaccggcgttgctcgtattgagttggatgtgcat
gaagacaccagcgtcatcgttctccatgccaagcagatgcagatctccaatgtgctgctc
ctggcacctgaaggtgtgaggcctcttcgggtgttggagtatcctcgtttccatcagctc
gccctgctgtcagactccgtgctgactaaagggaggaagtatgaagttcagctggggttt
gctgccaacttatctgacagctaccatggtttttacaaaagcagctaccgcaccagcgct
ggggaagtccggttcatggcctccacacagtttgaggcgacctttgctcgtggagccttc
ccctgttttgatgagcctgccttcaaagccaacttcaccatacggatcacacgagagcca
cgccacatagccatatccaacatgcctaaggttaaaacagtggcgttgccaggcggcttg
ctagaggatcacttcgacaccactgtaaagatgagcacttacctggtggcctacattgtg
tctgatttcctgtctgtgagcaagacgactcagcacggcgtcaagatttcaatctatgct
gtacctgagaagattgaccagacagcatttgcactggatgctgctgtgaagctgttggac
ttctatgatgactactttgatattccttacccgcttcccaaacaggacctggctgctatc
cctgacttccagtcaggtgcgatggagaactgggggctgaccacctacagagagacgggc
ctcctcttcgacgccgacaggtcttcagcttcagacaaactcggcatcaccaaggtcatc
gcccatgagcttgcacaccagtggtttgggaacctggtgacgatggagtggtggaatgac
ctgtggctcaacgagggtttcgccaagttcatggagtatatttctctcgacatcacctac
ccagagctgcatgtggatgacttcttcttggggaaatgttttgaggccatggaggtagac
tccctcagctcctcccacccagtctccacccccgtggaaaaccccatgcagatccaagag
atgttcgatgatgtgtcttatgacaagggagcatgtatcctgaatatgctgcgggacttc
ctgactccagaggcctttgagatcggcatcatccaatacctgaaacgctacagctaccaa
aacactgtcaacagccacctgtgggagagcctgactaatatctgcgactcagatgatctg
gacgaaggccgaatgaaacacaaagaattctgctccaaacgcaacgtgccgtctggagcc
tctaagtggtactctgatgatgagctggatgtcagggccatcatggacacctggacactg
caggagggcttcccgctggtcactgtggaggtcagaggtcgggaggtcagactcagtcag
gagcgttacctgaagacagatgacccctccctcactgaaggattcctgtggcagattcca
ctgacgtacatgaccagcgcctccagcaccatccaccgcttcctgcttaaaacaaagact
gacgtgctgtacctgccggaagaggtggactgggtgaagttcaatgtggacatgagcggc
tactacatggtccactacgcaggcaacgggtggaactccattatcagactgctgcaacac
aaccacatggcgctgaccagcaacgatcgtgccagcctcatacacaacgtcttccagctg
gtcagcatagggaaggtgaggttggacacggctctggaactgtctctgtacctgtccaga
gagactgagatcatggctgtgactcagggctttggagagctcgtacctctctacaaactg
atggagaagcgggacatgccggctctggagaaccagatgaagggctacattgtggatctg
ttcagggggctgattgatcggcaggagtggtctgactccggatcagtgtccgagcgagtg
ctcaggagttacctgctgctgtttgcctgtgtaaggaactacactccctgtgtgaccaaa
gccacccagctctttaaccagtggaaggcctctgatggcaaaatcagcctccctgtcgac
atcacaatggctgtgtttgtgattggagctcgaacaccagaggggtggaacttcttgttt
gagaagtaccgcaatgcgatgcaaatgtctgtcaagagccgcatgaaaactgccatgact
gtcacccccctgcaggacaagctcaagtggatgatggagcagagcctccgcggtgatgtg
atgaagactcaggacctcccagacgtggtcgtctcagtcagcaagaacccccatggcttc
aaactggcctgggacttcctccgagccaactggcacaccctgatcaagaagttcgacctc
ggctccagcactatatcatacatggtgactggggtgaccaaccagtattctaccagggag
acgttaaatgaggtacgaagcttcttcggctccctgaccgaggagacgggctcggagatg
aggtgtatccagcagacatatgagaccattgaggataacatccgctggatggacaccaac
cttcctctgctgcgggcctggctggacaaacacggacacaaagggcctcatgaggattta
tag

DBGET integrated database retrieval system