KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111644942
Entry
111644942         CDS       T06058                                 

Gene name
adamts13
Definition
(RefSeq) A disintegrin and metalloproteinase with thrombospondin motifs 13 isoform X1
  KO
K08627  a disintegrin and metalloproteinase with thrombospondin motifs 13 [EC:3.4.24.87]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slal01002]
    111644942 (adamts13)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.87  ADAMTS13 endopeptidase
     111644942 (adamts13)
Peptidases and inhibitors [BR:slal01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   111644942 (adamts13)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 ADAM_CR_2 Reprolysin TSP1_CCN TSP1_spondin Reprolysin_3 Reprolysin_4 Reprolysin_5 Reprolysin_2 CUB ADAM_spacer1 Peptidase_M10
Other DBs
NCBI-GeneID: 111644942
NCBI-ProteinID: XP_023249691
Position
Unknown
AA seq 1409 aa
MVFMTLLCLLLLRPGFSALMRSPLDELSRHSSSQRDIVSSPDSSPDASGMCSYGSMKTSI
TKSGRLRRSALMPDITHLELLVVVGPDVQQVHKQDTERYILTNLNIASELLRDMTLGANM
RVHLVRTIILSEPEPEIQMSTNITSSLRSVCDWGRRINPPNDSDPLHADLLLYVTRYDLV
LPDGNKQVRGVAQLGGACSSEWSCVITEDTGFDLGITIAHEIGHSFGINHDGVGNTCGRS
GFMMASDGGYNSVDLTWSPCSRQQLLTFFSEGKAGCVNDLPAMAGSLQDWKPGLYYGVDD
QCRIAFGSTARACSFSNPDLPVCRVLSCQINPDDDSSCKRLLVPLLDGTECAPNQWCLKG
RCVSPEELSSSVVVHGSWSSWSEFSPCSRTCGGGVTRRTRQCNNPRPAFGGNECQGLDID
AELCHQQPCERTQLDFMAEQCSQTDLQPLYLLPNTVSFYTWIPAVGFAQGDEQCRYMCQS
HGENFIVSRGSQFVDGTRCESDSPPPFGSTAACLRGKCQLFGCDGVLHSGKVRDVCGVCG
GDGSSCSLTSDSYTGGQAREYTTFLSLPVNASQAHIVNSAPLFTHMAVMVGDRYIVSGTG
TMALNMTHPSPLDDNRLEYRLHLTPDLLPAMEELLLPGPLKQDINIQVYRKYGKEYGEKT
NPNISYHYYVPTRNSDLTGITPKGKWVVFTTPCSVSCGLGIQKHVYVCADEDTNSHLEEH
NCETPLPPAPLHTTCQLSPCPPRWDTGTFGPCSASCGGGERVRPVRCVQKHGADEVNVPD
SECPPDTAPNAVEKCNLQHCPARWHVSEPGECSAVCGPGEAKRVVSCVRTEAGQDVEVDQ
SFCSKQIKPPDSVPCVVDVCPIGWESKGEDQPVLKSGLVPRSRQDPVYVWSPVISQCSKT
CGNGTLQVWFSCVDHQTRLGVPDFHCDASTKPSPHSEICSTSPCLPMWRSKQGVCSVTCG
GGVANRVLYCAREAEGEEEVVEDSECSDSLKPTAVVSCSTHSCPARWKVFSTSPCSVSCD
LGVAQRIVSCVQFVHGKESVVPEENCHAAVKPATTVPCLVQVCTFRWEVKPWSQCSAPCG
YGIQSRAVSCLGPSKPVPLSPLLCMHMPKPITIQGCYVDSCGDVVPTSDVASDTTTAMQT
VKTVNLTEGPLLSPTLSHKDTTLHRMGHLPPSPTEAITLPQTTTTSTPTPKGACGQLFLE
ESGTVDLKDVPNRCTVSIGRPLDEVIHIKVESSSLNCRKKEYVAFFDRLAFVRKCAQVAS
SELTTRTNVLLVRQNLLTPGNGIVFTYKSQKNTKRSHYRDCDIQLFSPSSDFENPTTSST
NHTCRVLINAPPSVKIRIQALHIGLVFNATNSQSTYIMIRDMDVLKTNVFKGQQLFQWHS
SGNMAEIEFHGDYLHSKGSFRAEYSFMRL
NT seq 4230 nt   +upstreamnt  +downstreamnt
atggtttttatgactctgctctgtctgcttttactgcggcctggcttcagcgctctaatg
agatctccattggacgagctatcccgtcactcctccagtcaaagagacatagtttcctct
cctgattcttctcctgatgcctctggtatgtgttcctatggcagcatgaagacatcaatc
acaaagagtgggcggctgcgtcggtcagcactgatgcctgatataacccacctggaactg
ctggtggtggtagggcctgatgtccagcaggtccacaagcaggatacagaaagatacatc
ctcaccaatctcaatattgcctcagagctgctgagagacatgaccctgggcgccaacatg
cgggtgcacctggtccgcacaatcatcctgtcggagccagagccagagatacaaatgtct
accaacatcacctcatctcttagaagtgtgtgtgactggggcagaaggataaaccccccc
aacgactcagacccgctacatgctgatcttttgttgtacgttacgaggtatgacctggtg
ttgcccgatgggaacaagcaggtcaggggagtagcgcagctgggtggggcttgctccagt
gagtggagctgtgtgatcacagaggacacaggctttgacctggggatcacaattgctcat
gaaattggccacagtttcggaatcaaccatgatggagtgggaaacacctgcggcaggagt
gggttcatgatggcttctgatggaggctacaacagtgtggatctgacctggtccccctgc
agcagacagcagctgctcacattcttcagtgaagggaaggctggatgtgtgaacgacctg
cctgcaatggcaggctccctacaagactggaagcctggtctctactatggagttgatgat
cagtgtcgtatagcttttggtagcaccgcaagagcatgctctttcagcaatcctgacctg
ccagtttgtcgtgttctgtcctgtcaaattaaccctgatgacgacagctcctgcaaacgt
ctcctggtgccactgctggacggtacagagtgtgcaccaaatcagtggtgtctgaagggg
cgttgtgtgtctccagaggagctcagctcctctgtggtggtgcatggctcctggtcgagc
tggtctgagttctccccctgttcacggacatgtggtgggggagtcactcgccgcacacgg
caatgcaacaacccaagacctgcttttggagggaatgagtgtcagggtctggatattgat
gctgaactttgtcaccagcagccgtgtgagcgcacccagctagatttcatggcagagcag
tgttcccagacagacctccagcccctttacctgctaccaaacactgtctccttctacacg
tggatccctgctgtaggttttgcacaaggggatgagcagtgcagatatatgtgccagtca
catggagaaaacttcatagtgagtcgtggctctcagtttgtggatgggactcgctgtgag
tcagacagtccgcctccctttggctctacagctgcttgtctaagagggaaatgccagctg
tttggctgtgatggtgtgctacactctgggaaagtgagggatgtgtgtggggtgtgtggt
ggagatgggtcgtcctgcagtttgacctctgactcctacactggtggtcaggcgcgagag
tacaccaccttcctctctctgccagtgaatgcctcacaggctcatattgtaaacagtgca
cctctcttcactcacatggctgtcatggttggggatcggtacattgtgtctggaactggc
accatggcactgaatatgactcacccctccccactggatgataaccgcctagaataccgc
cttcacctgacccctgaccttttgcccgcgatggaggaactgctgctgcctggcccgctg
aaacaggacataaacatacaggtctatcgcaaatatggaaaagaatatggcgagaagaca
aatccaaacattagttatcactactatgtacctaccagaaacagtgacttgacaggcatc
acacctaaaggcaaatgggtcgtctttacaacaccctgctctgtctcctgtggattaggt
atacagaagcatgtatacgtctgtgcagatgaagataccaacagccacctggaagaacac
aactgtgagacacctctgccacctgcaccactccatacaacctgtcagctttcaccctgc
cccccaaggtgggatacagggacatttgggccctgtagtgcctcctgtggcggaggagag
agggtgcgtcctgtaagatgtgtccagaaacatggagctgatgaggtgaatgttccagat
tctgaatgcccacctgatacagctccaaacgctgtcgaaaaatgtaacctgcaacactgt
ccagccagatggcatgtatcggagccaggggaatgctcggcagtgtgcgggccaggagaa
gcgaaacgtgtcgtgtcatgtgttcggacagaagctggtcaggatgttgaggtggatcaa
agcttttgttcaaagcagatcaaaccacctgactctgtaccctgcgtggtagacgtctgt
cccattgggtgggaatctaagggagaggaccagcccgtgctaaagtctggtttggtgcca
cgctctagacaagatcctgtatacgtgtggagccctgttatcagccagtgctcaaagacc
tgtggcaatggaaccctgcaggtgtggttttcctgtgtggaccaccagaccagactgggg
gtgccagacttccactgtgatgcttctactaaaccttctcctcattccgagatctgcagc
acatctccctgccttcccatgtggcgctctaagcaaggagtctgcagcgtaacgtgtgga
ggaggggtggccaacagggtgctgtactgtgctcgcgaagcagaaggggaggaggaggtt
gtggaggattcagagtgcagtgactctctcaaacccacagcagtggtttcatgtagcacc
cacagctgcccagcaaggtggaaggtgttcagcacgtcaccctgctctgtgtcctgtgac
ttgggtgtcgctcagaggattgtgtcttgtgtccaatttgtccacggcaaggagagtgtg
gtgccagaggaaaactgccatgcagctgtcaaaccagccaccacagtgccctgcctggtg
caagtctgcaccttcaggtgggaggtgaagccatggagccagtgttcagcgccctgtgga
tatgggatccagtccagggctgtgtcctgtctgggcccctctaagcctgtgcccctcagc
cctctgctttgcatgcacatgcccaaacccattaccatccagggctgctatgtggacagc
tgtggagatgtggtgcccacatcagatgtggcctctgacaccaccactgcaatgcagact
gtcaagacggttaacctcacagagggacctctcctgtctcccactctcagccacaaagat
acaacactgcaccgcatgggccatcttcctccaagtccaacagaggccatcaccctccca
cagaccaccacgacaagcaccccaacccctaaaggcgcatgtggacagctattcctggag
gaatcaggcacagtggatttgaaggatgtacccaaccgctgcacagtgtccataggtcga
cccctagatgaggtcattcacatcaaagtggaatccagctccttgaattgcagaaaaaag
gagtatgtggcattttttgaccgactggcatttgtgaggaagtgtgcacaggtagcaagc
agcgaactgaccactaggactaatgtcctgctggttcgtcaaaatctgctcactcctggg
aatgggattgtgttcacctacaagtcacagaaaaacacaaagaggagccactatcgggat
tgtgacattcagctgttttcccccagcagcgactttgagaacccaacaacgtccagcact
aaccacacctgtcgagtgctcatcaatgcacctccctctgtgaagatcagaatccaagca
ctacacataggattagtattcaacgccaccaactcccagtcgacgtacattatgatccgg
gacatggatgtcttaaagaccaatgtatttaaaggccaacagctgtttcagtggcactcc
tctggaaatatggctgaaattgaatttcatggagactacctgcattccaaaggaagcttc
agagctgaatattcctttatgaggctttga

DBGET integrated database retrieval system