KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645368Help
Entry
111645368         CDS       T06058                                 

Gene name
dock7
Definition
(RefSeq) dedicator of cytokinesis protein 7 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111645368 (dock7)
Membrane trafficking [BR:slal04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111645368 (dock7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 111645368
NCBI-ProteinID: XP_023250319
Position
Unknown
AA seq 2156 aa AA seqDB search
MAERRAFAQKISRTVAAEVRKQIAGQYGGSPQLFKNLNVGTTTSNTVPLTEAVEPVDFEE
YLITHPPIVESGPLRDLIEFPPDDIEVIYTPRECRTVVQAVPEEGDTDPHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQVFEADEMPDSSSYQDDQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDALLPHLLDRAPNEEIDRHNEDQRKANRHRELFALHPAL
DEEEPIERHCVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFFF
DLNSEQTKAMLRPHIQTAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPY
MVFKESDAAKNKEKLEKLRGQSEQFCQRLGRYRMPFAWTAIHLMNIVNSAGSLERDTELE
MSLSERKGSWSERRNSSIMGRRSLERTTSGDESCSLTGFRPATLTITNFFKQEGDRLSDE
DLYKFLADMRRPSSVLRRLRPITAQLKLDISPAPENPHYCLTPDLLQVKPYPDSRVRPTR
EILEFPARDVYVPNTTYRNLLYVNPQSLNFANRQGSARNITVKVQFMNGEDPNNAMPVIF
GKSSCADFSKEAYTAVVYHNRSPDFHDEVKIKLPASLSDHHHILFTFYHVSCQQKQNTPL
ETPVGYTWIPMLQNGRLRTGHFCLPVSLEKPPQSYSVLSPDVPLPGMKWVDNHRGVFNVE
VVAVSTIHTQDQYLDKFFALVHALDEHMFPVRIGDMRIMENNLEAELKSSIAALNSSQLE
PVVRFLHLLLDKLVLLVVRPPVIAGQIVNLGQASFEVMASIVNRLHKYLDTSQDMHGRNS
LLSSYIHYVFRLPSTDPNSPSPDPNSSLTGPGGLGGSVHYATMARSAVRPASLNLNRSRS
LSNSNPDISGTPTSPDDEVRSIIGSKGLDRSNSWVHTMGCKSAPWGSSPGSAPETMQAME
RCGNRMSSHTESASFLQTLTGRLPTKKLFHEELALQWVVSSGSVREGALQQAWFFFELMV
KSIIHHLYFADRLESPRKNRFPERFMDDITALVSTIAGDIVSRFQKDLELVERLNTSLAF
FLNDLLSVMDRGFVFTLVRAYWKQVSTKLYTLQNPTLESLRLDFLRIVCSHEHYVTLNLP
CSLLTPPASPSPSVSSATSQSSGFSTHVQDQKIANMFELSVPFREQHYLAGLVLSELSVI
LDPDNEGMFGLHKKVVSVVHNLLSSHDSDPRYADPEVKARVAMLYLPLIGIVMETLPQLH
DFTESHNQWGRPGGPQGAAVGSSGEEAEGEGNSMISQTVAMAIAGTSTASPMSRPSSFLL
NSQASRQHGSFSAESSRSLLICLLWVLKNADELVLQKWFTDLSVSQLNRLLDLLYLCVSC
FEYKAHVVFTMQGKKAFERMNSLTFKKSKDMKAKLEEAILGSIGARQEMVRRSRGQLERS
PSGSAFGSQENLRWRKDMTHWRQNSEKMDKSHRSVRTRAELEHEALIDGNLATEANLIIL
DTLEIIVQTVSVTESKESILGGVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFE
EETEQCADLCLRLLRSCSSSISTIRAHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSL
VGTSQNFNEEFLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQE
DPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERNNHAEAAQCLVHSAALVAEYLSM
LEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGICSGKYFTEIGLVGLLEQAAAS
FSMAGMYEAVNEVYKVLIPIHEANRDAKKLATIHGKLQEAFGKIVHQSTGWERMFGTYFR
VGFYGSKFGDLDEQEFVYKEPAITKLAEISHRLEGFYGERFGEDQVEVIKDSNPVDKCKL
DPNKAFIQITYVEPYFDTYEMKDRITYFDKNYNLRRFVYCTPFTLDGRAHGDLHEQFKRK
TILTTSHAFPYIKTRINIIHKEEIISTPIEVAIEDMQKKTQELAFATHQDPADAKMLQMV
LQGSVGTTVNQGPLEVAQVFLSEIPSDPKLYRHHNKLRLCFKDFTKRCEDALRKNKSLIG
PDQKEYQRELERNYHRLKEALQPLINRKIPQLYKPVLQVNSHRDSFSRMSLRKLDI
NT seq 6471 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacgccgcgccttcgcccaaaaaatcagcaggactgtggcagcagaggtcagg
aagcagatagctggccagtatgggggctcaccacaactgttcaaaaacctcaacgttggg
accacaacaagcaacacggttcccctcacagaggcggtggagccagtggattttgaggag
tacctcatcactcaccctcccatcgttgagtcgggtcccctgagggatctgattgagttt
cccccggatgacattgaggtcatctacacacccagggaatgtcgcacagtggtacaagct
gtccctgaggaaggggacactgatcctcacgtcagagactgtgtcagatcctacacagaa
gactgggccattgtcaacagaaaatatcacaagcttggtacgggctttaaccccaacact
ctagacaagcagaaggagcgtcagaaaggcctgcccaaacaagtgtttgaggctgatgag
atgccagacagcagcagctaccaggatgaccaggatgacttgaagcggcggtcgatgtct
atagatgacaccccacgcggcagctgggcctgcagcatctttgacttgaagaactccctc
cctgacgccctcctccctcacctgctcgatcgtgctcctaatgaggagattgacaggcac
aatgaagaccagcgcaaggccaaccgccaccgtgaactcttcgctctgcaccctgccctt
gatgaggaggagccaattgaacgccactgtgtgcctgaagtacctaaagaacactttggc
cagaggctactcgtcaagtgcttgtccttgaagtttgagatcgaaattgaacccatattt
gctagtttggccttatacgatgtcaaggaaaagaaaaagatatcagagaactttttcttt
gacctgaactctgagcagacgaaggccatgctgcgtccacacattcagacagcggccatc
tctacactggcacgctctgctatattttccatcacctacccctcccaggacgtctttctg
gtcatcaagctggaaaaggtactgcagcaaggtgatattggagagtgtgctgagccctac
atggtcttcaaagagtcagatgctgccaagaataaagagaagttggagaagcttcgcggc
cagtcagagcagttctgccaacgtcttggccgctaccgaatgcccttcgcttggaccgct
attcatctaatgaacattgttaacagcgctggcagtctggagagagatacagagctggag
atgagcctctcagagagaaaaggctcgtggtcagaacggaggaactcaagcatcatggga
aggcgttcccttgagaggaccaccagtggagacgagtcatgtagtctgacaggctttaga
cctgcaacacttaccatcaccaacttcttcaaacaggagggggacaggctgagtgatgag
gatttgtataagttcctagcagatatgagaagaccgtcttcagtgctgaggagactcaga
cccatcacagcccagttaaagttggacatttctccagctccagagaacccccactattgc
ttgactcctgacctcctgcaggtcaaaccttacccagacagcagggtacgccccaccagg
gagatcctggagttccctgccagggatgtctatgtgccaaacaccacgtacaggaatctg
ctgtatgtgaaccctcagagtcttaactttgccaaccgccaaggctctgcccgtaacatc
acagtgaaagtacaatttatgaatggagaggatccaaacaatgcaatgccggtgatattt
gggaagtccagctgtgcagatttctctaaagaggcctacactgctgtggtgtaccataac
agatcacctgactttcatgatgaggtcaagatcaagttgcctgcctccctgtcggaccac
caccacattctcttcaccttttaccatgtcagctgtcagcagaagcaaaacacacctctg
gagacccctgtgggatacacgtggatccccatgttgcagaatgggcgtctacggacagga
cacttttgtctccctgtgtcactggagaaaccaccacaatcctactctgttctctcccca
gatgttcctctcccagggatgaagtgggtggataaccatcgtggagtattcaatgtggaa
gtcgtggctgtttcaaccattcacacacaggaccagtacctggataagttctttgccttg
gtacatgccctggatgagcacatgtttccagtcaggataggagacatgcggatcatggag
aacaacctggaggctgagctcaagtccagcattgcagctctcaactcttcccagctggag
ccagtggttcgattccttcatctcctactcgacaagttggtgttgcttgtagttcggccg
ccggtcattgctggacagatagtgaatctgggccaggcatctttcgaggtcatggcgtct
atagtgaaccggcttcacaagtacctggacaccagccaggacatgcatggccgcaacagc
ttgctgtcctcttacatacactacgtcttccgattgcccagcactgaccccaactcacca
tcgccagaccccaactcatccttaacaggcccgggggggttgggaggttcggttcactat
gccaccatggctcgctcagccgttcgaccagccagcctcaacctcaaccgctcccgtagc
cttagcaacagtaaccctgacatttccggtacacccacttctcctgatgatgaggtccgc
tccatcattggcagcaagggcttagaccgctccaactcgtgggtgcacaccatgggctgt
aagagtgccccctggggatccagccctgggtccgctccagaaaccatgcaggccatggag
cgctgtggcaatcgcatgtcttcgcacactgagagcgccagtttcttgcaaactttaaca
ggacggttgcccacaaaaaagctcttccatgaggagttggccctccagtgggtggtgagc
agtgggagcgtaagggagggtgctctacagcaggcctggtttttctttgaactcatggtg
aagagcattatccaccacctttacttcgctgaccgcttagagtcgcccaggaagaaccgt
tttccagaacgcttcatggatgacattacagccctggtcagcaccattgctggtgacatt
gtctctcgattccagaaggacctggagcttgtggagagactaaacactagtctggccttc
tttctcaatgacttactgtcagtcatggaccgaggctttgtctttaccctcgtcagggca
tactggaaacaggtgtccacaaaactttacactctgcagaacccaaccctggagtctttg
aggcttgacttcttgagaattgtttgcagccacgaacattacgtcaccctcaatctgccc
tgcagtctgctcacaccacctgcctcgccttccccctctgtgtcttcagcgacctcacag
agctctgggttctccacacatgtccaggatcaaaagatagccaacatgtttgagctgtct
gtccccttccgagagcagcactatctggctggactggtgctgtctgaactgtctgtaata
ctggacccagacaacgaggggatgtttggtctccataagaaagttgtgagtgttgttcat
aacctcctgtccagccacgactctgacccacgctacgcagatcctgaggtcaaggcccgg
gtcgccatgctgtacctgcctctaattggtattgtcatggaaacactaccacagctccat
gacttcacagagtcccataaccagtggggtcggccgggtggtccacagggggcagcggtg
ggcagcagtggagaagaggcagagggagagggtaacagcatgatcagccagactgttgcc
atggcgatagcaggcacctccactgcctctccaatgtcacgaccaagcagcttcttgctc
aactcgcaggcgagtcgtcagcatggaagcttctcggccgagtcaagccgtagtctgctc
atctgtctgctgtgggtgctgaagaatgccgacgagctggtgttacagaagtggttcaca
gacctgtcagtgtcccagctcaaccgcctgctggaccttctctacctctgcgtctcctgc
tttgagtacaaggcccatgttgtgttcaccatgcaggggaagaaggcgttcgaacgaatg
aacagtctgacctttaagaagtccaaagacatgaaggcgaagctggaggaggccatactg
ggcagcattggtgccagacaggagatggtgcgacgcagccgcggacagctagagcggagt
ccatctggcagcgcttttggcagtcaggagaaccttcgatggaggaaggacatgacccac
tggagacaaaacagcgaaaagatggacaagagtcacagatcagtcaggaccagggcagag
ttggaacatgaagcacttattgatggtaaccttgcaacggaggccaacttaattattctt
gatactttggagatcattgtacagacagtatcagtgacagaatccaaggagagtatcttg
ggcggtgtgctgaaggtgctgctccacagcatggcctgcaaccagagcgccctctacctc
cagcactgttttgccacacaaagggcacttgtgtctaagtttcctgagctgctgttcgag
gaggagacagagcagtgtgctgacctgtgtttgcggctactgaggagctgcagcagcagc
atcagtaccatcagggcccacgccagcgcttccctctacctcctcatgaggcaaaacttt
gagatcggcaacaactttgcaagagtgaagatgcaggtgaccatgtctctttcctcgctg
gtgggaacatctcagaattttaatgaggagttcttgcgtcgttctctaaagaccatcctt
acatacgcagaggaggacctggagctgagggagaccacattcccagaccaggtccaggac
cttgtgtttaacctgcacatgattctctctgacacagtgaagatgaaggagcaccaggaa
gatcctgagatgctgatagatctcatgtacaggattgcaaaaggttatcagacctctcca
gacttgcgactgacgtggctccagaacatggctggaaaacactcagagaggaataaccac
gctgaggctgctcagtgtctggtgcacagcgctgctctggttgcagaatacttgagcatg
ctggaggaccgcaagtatctgcctgtgggctgtgtcacattccagaacatttcctccaat
gtgctggaggaatctgcagtctctgatgatgtggtgtcaccggatgaagagggcatttgc
tcaggcaaatactttactgagatcggtctcgtgggactcctggagcaggctgctgcctct
ttctccatggccggcatgtacgaggcggtaaacgaagtgtacaaggtactgatccctatt
catgaagccaacagggacgcaaagaagctggccaccattcatggtaaactacaggaagcc
tttgggaaaattgttcaccagagtactggctgggagaggatgtttggtacatacttcaga
gttggattttacggttcaaaatttggcgatttagacgagcaagagtttgtctacaaagag
cccgccatcacgaagctagcagaaatctctcacaggctggagggtttctatggggaacga
ttcggagaggaccaggtagaagtcattaaagattccaacccggtggacaagtgcaagttg
gacccaaataaggcattcatccagatcacatatgtggagccgtattttgacacatacgag
atgaaggaccgcatcacctactttgacaagaactacaacttgcgacgtttcgtgtactgc
acccctttcaccctggatgggcgggcacatggggacctgcatgaacagttcaaacgcaag
accatcctcaccacctcccacgccttcccttatatcaagacacggatcaacatcatccac
aaagaggagattatttccacacccatcgaggtggcaatagaggacatgcaaaagaagact
caggagttggcctttgccacccaccaggaccctgctgatgccaagatgttgcagatggtc
ctacagggatcagttggtacaacagtcaaccagggtcccttggaggtggctcaggtgttc
ctctcagaaatccccagtgacccaaaactgtacaggcaccacaataagctacggctctgc
ttcaaagacttcaccaagaggtgtgaagacgccctgcgtaagaacaagagcctgattggt
ccagaccagaaagagtaccagagagagctggagaggaattaccaccggctgaaggaggcg
ctgcagcccctcatcaacagaaagatcccccagctttacaaaccggtactgcaggtcaac
tcacacagagattccttcagcagaatgagtcttcgcaagcttgacatttga

DBGET integrated database retrieval system