KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645380Help
Entry
111645380         CDS       T06058                                 

Gene name
pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00564  Glycerophospholipid metabolism
slal00565  Ether lipid metabolism
slal00590  Arachidonic acid metabolism
slal00591  Linoleic acid metabolism
slal00592  alpha-Linolenic acid metabolism
slal01100  Metabolic pathways
slal04010  MAPK signaling pathway
slal04217  Necroptosis
slal04270  Vascular smooth muscle contraction
slal04370  VEGF signaling pathway
slal04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    111645380 (pla2g4a)
   00565 Ether lipid metabolism
    111645380 (pla2g4a)
   00590 Arachidonic acid metabolism
    111645380 (pla2g4a)
   00591 Linoleic acid metabolism
    111645380 (pla2g4a)
   00592 alpha-Linolenic acid metabolism
    111645380 (pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111645380 (pla2g4a)
   04370 VEGF signaling pathway
    111645380 (pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111645380 (pla2g4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    111645380 (pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111645380 (pla2g4a)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     111645380 (pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 111645380
NCBI-ProteinID: XP_023250353
Position
Unknown
AA seq 749 aa AA seqDB search
MASNIIVEQQFSHKFTVTVVRAENVTKGALGDLLDTPDPYVELFIPTAPESRKRTKHIDN
DINPKWDETFHFILDPNQQNVLELTLMDANYVMDETLGTTSFDLTKLRVGQTKMETFFIG
KATKVYLEMLLEICTNLDLRFSLALCDKEKQFRQTRRERVMLGIKKLLDMEKPRFLPSSP
QEVPVIAIAGSGGGFRAMVGFSGVMKALFESGVLDCATYVAGLSGSTWYMSTLYSHPDFP
NKGPMDINKELMKRVSSNPLRLLLPQHITNYIQALWTKKASGQPVTFTDIFGMLIGETLI
PARMDTKLSEIQEKIDQAQSPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYGTFMT
PDLFGSKFFMGTVVKKYEENPLHFLMGVWGSAFSILFNRVLGVKDTAGGSTMEEELEQIK
PQHIVGEDSLDNDDEPRKGGTENQEAEDEFHRTAQASWVQRMFTSLFSDSALFNTREGRA
GKVHNFMLGLNLNTSIPFSPVTEVTYNTPPPEEEVDAVTDPDEFDRIYEPLDVKSKKIHV
VDSGLTYNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPFPKI
DPKVFDREGLKECYVFKPKKGEKNCPTVIHFVLVNINFRQFKAPGVPRETEKEKELADFD
IFDDPESPFSTFNFQYSNEAFIRLHDLMEFNTLNNLEVIKEAIKDCIVSRKENPSGLSLP
FSLSEIPKKKFFRRDPHPKPWNHLGNDNQ
NT seq 2250 nt NT seq  +upstreamnt  +downstreamnt
atggcttccaatataattgtggaacagcagttttctcacaaattcacagtgacagtggtt
cgagctgagaacgtcaccaagggagcgctgggtgacctgttggacaccccagatccatat
gtggagctgttcatcccaacagccccagagagcagaaagaggaccaagcacatagacaac
gacatcaacccaaaatgggacgaaaccttccacttcatattagaccccaaccagcagaac
gtcctggagctaacattaatggatgcgaattatgtgatggatgagacacttgggacgacg
tccttcgaccttaccaagcttagagtgggccagacaaagatggagactttctttattggc
aaagcaaccaaagtgtacttagagatgttgctggagatctgtaccaacctggacctgcgg
ttcagcctggccctgtgtgacaaagagaaacagttcagacaaacccgcagagaaagagtg
atgctgggcatcaagaagctgctagacatggagaagcctcgtttcctccccagctctcca
caggaggtaccagtgatagccatagcaggctcaggaggcggtttccgtgccatggtgggc
ttctcaggtgtgatgaaggcgctgtttgagtctggggtcctggattgtgccacatatgtt
gccggcctctctggatccacatggtacatgtcaactctctattcccaccctgactttcca
aacaagggcccaatggacatcaacaaggagctaatgaagagagttagcagtaacccactg
aggctgttgctgccccaacacatcaccaactacatccaggccctttggaccaaaaaggcc
tcagggcagcctgttacctttactgatatctttggtatgctcataggagaaacgcttatt
cccgcgaggatggacactaagctaagtgaaatccaggagaagatagaccaggcacagagt
ccccttcctctcttcacatgtctgcatgtcaaaccagatgtttctgagctcatgtttgca
gactgggtggagttcagcccatatgaaattgggatggcaaagtacggtaccttcatgacc
ccagacttgtttggaagcaagttcttcatgggaactgttgtgaagaaatatgaggaaaac
cctcttcattttctgatgggtgtgtggggcagcgcgttctcgattctgttcaacagagtg
ctgggcgtcaaagacacagctggtggcagcaccatggaggaggagttagagcagatcaaa
ccgcagcacattgtcggagaagacagtttggacaatgacgacgagccacgcaaaggtggg
acagagaaccaggaggcagaagatgagtttcatcgcactgctcaggccagctgggttcag
cgaatgttcacatcgctcttcagtgactctgccttgttcaacacaagagagggcagggct
gggaaggtgcataacttcatgctgggcctgaacctgaacaccagcatcccattctctcct
gtcactgaggttacatataacactcctccacctgaggaggaggtggatgctgtcacagac
ccagatgagtttgatcgtatctacgagcctctggatgtgaagagtaagaagatccacgtg
gtggacagcggcctgacctacaacctcccgtaccctctcatcctgcggccgcagcgtggc
gttgacctcatcatctcctttgacttttctgcacggccaagcgactcaagcccaccattc
aaggagcttctgctagcagaaaagtgggctcgaatgaacaagctcccattccccaagatc
gacccaaaagtctttgaccgcgaaggcctgaaggaatgctatgtcttcaaaccaaaaaaa
ggagaaaagaactgccctactgtcatccactttgtcctggtcaacatcaacttcaggcag
ttcaaagcgcctggtgttcccagagaaactgagaaggagaaggagttggcggattttgac
atttttgacgaccccgagtcacctttctccactttcaatttccagtactccaacgaggcc
tttatccgactccacgacctcatggagttcaacactctcaacaacctggaggttattaaa
gaagccatcaaagactgcattgtctctcggaaagagaacccctcaggcctctcccttccc
ttctcactcagcgagatcccgaaaaagaagtttttcagaagagatcctcacccaaaacct
tggaatcacttgggaaatgataaccagtag

DBGET integrated database retrieval system