KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111645488
Entry
111645488         CDS       T06058                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
slal04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    111645488 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111645488 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 111645488
NCBI-ProteinID: XP_023250492
Position
Unknown
AA seq 112 aa
HTLIYTCLWFPHPLPLRSLFGSCYTFSIIKSNVILLVRGGCEVESNWSVLCVFACPPGPM
ASMEHGRELEEASTVRKMVQQSPARGGQTHRPAGWKRRRPRPRLSHKGPMPF
NT seq 339 nt   +upstreamnt  +downstreamnt
cacacacttatctatacatgtctctggtttcctcatccattaccactgcgatccctcttt
gggtcttgctacacattttccataatcaagtcaaatgtgatacttttggtgagaggaggt
tgtgaagtcgaatctaattggtccgtcctctgtgtgtttgcgtgtcctccaggtcccatg
gcctccatggagcatggcagagagctggaagaggcctctacagtgagaaaaatggtccag
caaagccctgcgaggggcggtcagacccacagaccagccggctggaagaggagacgccca
cggccccgtctttcccacaaggggcccatgccgttctag

DBGET integrated database retrieval system