KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111647178
Entry
111647178         CDS       T06058                                 

Definition
(RefSeq) ankyrin repeat domain-containing protein 53-like
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:slal03036]
    111647178
Chromosome and associated proteins [BR:slal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    111647178
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 111647178
NCBI-ProteinID: XP_023252558
Position
Unknown
AA seq 399 aa
MEPVNKPGKRRRGRCKNWTEPHRAQADLLMFPAVDGGSPRKVDFRVDRQGLSELHMACLY
GQLDYIQLLVESTLGGINSRDPQGRRPIHMVMSSRSSPNTCACLRYLLENGAEINVTTDS
GQTALHLAASEGFLDCTEILVQASADVLAQDIMGHTPLDFARIWCRRKVARYLKNCMWKA
EKKKEMEGRKLVQALYTDLVDMVKLNNLKRRTLIDEKMAEWANKKGLPHLRDFSPKILVS
QYHTECLSSDQDRSNLKHTKGLSKHQPRAPQEDQAITSSKPRASASRPWTIYMGLQPERP
PAVPDLRDSVTVWRDSRSRQPHYSTKWDNMPRATPDLPLDVLERVLFPRAFPSRIVSPRH
FEPQNIVEVQQRGCPQGRSTSPWTEVAMHLAEVLEPGHY
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggaacccgtcaacaaacccggaaaacggagacgtgggagatgtaaaaactggacagag
ccccacagagctcaggctgacctgctcatgttccctgctgtggatggagggagcccgagg
aaggtggacttccgggtggacagacagggtctgtcagagctccacatggcctgcctttac
ggccagcttgattatattcagctcctggtggagtccacgttgggggggatcaacagcagg
gatcctcagggtcgccggcctattcacatggtcatgtcttcccgaagctcacccaacacc
tgcgcctgcctcagatacctgctggagaacggagctgagattaatgtcaccacagactca
gggcagacggcgctgcacctggccgcctctgaaggcttcctggactgcacagagatcctc
gtgcaagccagtgcagatgtgttggcccaggacatcatggggcacacacctctggatttc
gcccggatctggtgccgcagaaaggtagcaaggtatctgaaaaactgcatgtggaaggca
gaaaagaagaaagaaatggaggggaggaagctagttcaagctttatacactgatcttgtg
gatatggtcaaactgaataatctcaaaagaaggacacttatagatgagaagatggcagag
tgggcgaacaagaaaggtcttcctcacctaagggatttctcccccaagatcttggtgagc
cagtaccacaccgagtgcctctcatcagatcaggaccgctctaatctgaaacacaccaaa
ggcctgagtaagcaccagccgagagctccccaggaagatcaggcaatcacctcctccaag
ccgagggcctcagcctccaggccctggaccatctacatgggcctccagccagagagaccc
cctgcggtgcctgacctccgagacagcgtcacagtgtggagggacagcaggagcaggcag
ccacactacagcaccaagtgggacaacatgcctcgtgccacccctgacctgcctctggac
gtcctggagagggtgttgttccccagagccttcccttccaggattgtctcccctcggcac
tttgagccacagaacattgtggaggtccagcagcgaggatgcccccaggggcggagcacc
tccccctggacggaggtggccatgcacctggctgaggtactggagcctggacactactga

DBGET integrated database retrieval system