KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111648165Help
Entry
111648165         CDS       T06058                                 

Gene name
ppid
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase D
  KO
K05864  peptidyl-prolyl isomerase D [EC:5.2.1.8]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04217  Necroptosis
slal04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:slal00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111648165 (ppid)
   04218 Cellular senescence
    111648165 (ppid)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:slal03110]
    111648165 (ppid)
Enzymes [BR:slal01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     111648165 (ppid)
Chaperones and folding catalysts [BR:slal03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    111648165 (ppid)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase TPR_1 TPR_2 TPR_11 TPR_9 TPR_12 TPR_16 TPR_6 TPR_19 DUF627 MIT Seryl_tRNA_N
Motif
Other DBs
NCBI-GeneID: 111648165
NCBI-ProteinID: XP_023253731
Position
Unknown
AA seq 370 aa AA seqDB search
MSHPTPSDKPSNPENPRVFFDVEIDGEKAGRIVLELFADITPKTAENFRALCTGEKGTGK
STGKPLHFKGCPFHRIIKKFMIQGGDFSNHNGTGGESIYGEKFEDENFHYMHDKVGLLSM
ANAGPNTNGSQFFITTVPTPHLDGKHVVFGQVLKGIGIIKMLESIDTQDDAPVKPCIVAD
CGEHKDGDSWGVAPSDGSGDTHPDFPEDSDIDFKDVDKVLSVAEDVKNIGNNLFKNQNWK
AAVNKYSKALRYLEVSGDQLEEDAQLKLEPTALSCFLNTAACKLKMQLWQDALDSCSEAL
ELDQANTKALFRRAQAWQGLKEYSKAMTDLKKAQEKAPEDKAISNEMKRVQFKIQEEKEK
EKKIYAKMFA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacccaacaccgtctgacaagccttccaaccctgagaacccccgtgtcttcttc
gatgtagaaatcgacggagaaaaagctggccgaatagtcttggagctgtttgctgatatc
actcccaagactgctgagaactttcgggcactctgcactggagagaaaggcactggcaaa
tcaaccgggaaaccgctgcacttcaaaggatgcccattccacagaatcatcaagaaattc
atgatccaaggaggtgacttctccaaccataatggcaccggtggagagagcatctacggg
gagaagtttgaggatgaaaacttccactacatgcatgacaaagtgggtctactaagcatg
gccaatgctgggccaaacaccaacggctcacaatttttcatcactactgtccccacgcca
cacttagatggaaagcatgtggtctttggacaagtcttgaaagggattgggatcataaaa
atgttggagtcgattgacactcaagatgatgcccctgtaaagccatgtatcgtagcagac
tgtggtgagcataaggacggggacagttggggtgttgcaccaagcgatggatcaggggac
acccatccagacttccctgaggactctgacatcgactttaaagatgtcgataaagttctg
tctgtcgctgaggacgtcaagaacattggaaacaacctttttaagaatcaaaactggaaa
gctgctgtcaacaaatacagcaaagccctcaggtacttggaggtgagtggagatcagctg
gaggaggatgcgcagctgaaactggaacccacagccctcagctgcttcctcaacacagca
gcttgcaagctgaagatgcagctgtggcaagatgccctggacagctgcagtgaggctcta
gagctggaccaagcgaacactaaagcgcttttccggagggcccaggcctggcagggctta
aaggaatacagcaaagccatgactgatctgaagaaagctcaggagaaagctccagaagac
aaagctatcagcaacgagatgaagagagttcagtttaaaatccaggaggagaaggagaaa
gagaagaaaatctatgccaaaatgtttgcttga

DBGET integrated database retrieval system