KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111648178Help
Entry
111648178         CDS       T06058                                 

Gene name
mars2
Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00450  Selenocompound metabolism
slal00970  Aminoacyl-tRNA biosynthesis
slal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    111648178 (mars2)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    111648178 (mars2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slal01007]
    111648178 (mars2)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slal03016]
    111648178 (mars2)
Enzymes [BR:slal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     111648178 (mars2)
Amino acid related enzymes [BR:slal01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   111648178 (mars2)
Transfer RNA biogenesis [BR:slal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    111648178 (mars2)
 Prokaryotic type
   Other AARSs
    111648178 (mars2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1
Motif
Other DBs
NCBI-GeneID: 111648178
NCBI-ProteinID: XP_023253752
Position
Unknown
AA seq 593 aa AA seqDB search
MRFPFRSVARSCKAVHKLRQSPFLLPDCAVSRHQRIAVLSHQCKDERSYYITTPIFYVNA
SPHLGHLYSAVIADCLHRYKLLQGFNSKFSTGTDEHGLKIQQAAEAAGKDPLTFCTDVSE
RFKHLFSSCNISYTDYIRTTEQRHRQAVEHFWSVLWKKGHIYKGHYEGWYSTQDESFLTP
MQVDDAVDSSGKEIKVSLESGHKVEWMKEENYMFRLSAFRSQLLDWLRGNPQAVQPEHFY
QIVLQWLEHDLPDLSVSRHRSRLQWGISVPNDPEQTIYVWLDALVNYLTVAGYPDNHDQW
WNVAHHVVGKDILKFHAVYWPAFLLGAGLPLPQTIHVHSHWIAGGKKMSKSLGNVVDPLQ
RSQLFTTDGMRYFLLRQGVPDSDCDYTDHKVLKLLNAELTDSLGGLLNRCTATALNPAQV
YPSFCPLSFPREQGGRAVVEDYLMLDAVKNLPAVVEQHYESMHVYKALEAITACVRQTNG
FVHRHAPWKLDKRNSKEQRWLDTIIHVSLECLRVYGTLLQPIVPEISNKLLSRLGVQPGE
RSWAALNFLPTYQGMDCPFEGRALGSDTGVLFSRLESQNVDEQKHNKAKRKKN
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcccttttcgttctgttgccagaagttgtaaggctgttcacaaactgcgacaa
agccctttcttattaccagattgtgctgtgtcgagacatcagaggatcgctgtgttgagc
catcaatgcaaagatgagaggagttactacataaccacccccatcttctatgtcaatgct
tctcctcatttaggacacctgtattcggctgtgatagctgactgccttcacaggtacaag
ctgcttcaagggttcaactcaaagttttcaacaggcacagatgagcatggcttgaaaatc
caacaagctgctgaagctgcaggaaaagatcccctgaccttctgcactgatgtgtctgaa
agattcaaacatctcttcagcagctgcaacatttcgtacacagactacataagaaccact
gagcagagacaccgtcaggcagtggagcatttctggtcagtgctctggaaaaaaggacac
atctacaaggggcattatgaaggctggtactccacacaggatgaaagtttcctcacgcca
atgcaggtggacgacgctgtggactcatcagggaaggagatcaaggtgtcgctggagagt
ggacacaaggtggagtggatgaaagaggagaactacatgttccgtctgtctgcgtttcgg
tctcagctgctcgactggctcagaggaaatccccaggccgtacagcctgaacatttctac
cagattgttctccagtggctagagcacgaccttccagacctgtcagtgtcccggcataga
agccgccttcagtggggcatctcggtccccaacgaccctgagcagaccatctacgtgtgg
ctagatgctctggtgaactacctcacagtagctggctatccagataaccacgaccaatgg
tggaatgtggcccaccatgttgtaggaaaggatatcttaaaatttcatgccgtctactgg
ccagctttcctcctgggagctggactgccgctgccacagacgatacatgtgcactctcac
tggatagcgggaggaaagaagatgtctaaaagtttgggtaatgtggtagatcctcttcaa
cgctcacagttgtttacaactgatggtatgaggtactttcttctgcgtcagggtgtccca
gactcagactgtgattacacagatcacaaagtactcaagctactcaacgcagaactaact
gactccctgggaggtctgcttaaccgctgcacagctacggctcttaacccagcgcaggtc
tacccctctttctgtcctctgtccttcccaagagaacagggaggcagggctgtggtcgaa
gactacctcatgttggatgctgtgaaaaatctccccgctgtggtagagcagcactatgag
agcatgcatgtgtacaaagcgctggaggccatcactgcttgtgtgaggcagaccaacggg
tttgttcatcgccacgcaccttggaagctggacaagaggaacagtaaagagcagcgctgg
ctagacactatcatccatgtttcccttgaatgcctgagggtttatggcacactcctccag
ccaatagtgccagagatttccaacaaactcctgtccaggctcggggtgcagccaggtgag
aggagctgggcagctctgaacttcctgccaacgtatcagggaatggactgtccctttgaa
gggagagcactaggatctgacactggagtactttttagtcgcttggaaagtcagaatgtt
gatgaacaaaaacataacaaagcaaaaaggaaaaaaaattga

DBGET integrated database retrieval system