KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111648430Help
Entry
111648430         CDS       T06058                                 

Definition
(RefSeq) dedicator of cytokinesis protein 7-like isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111648430
Membrane trafficking [BR:slal04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    111648430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TEA
Motif
Other DBs
NCBI-GeneID: 111648430
NCBI-ProteinID: XP_023254052
Position
Unknown
AA seq 132 aa AA seqDB search
MASIVNRLHKYLDTSQDMHGRNSLLSSYIHYVFRLPSTDPNSPSPDPNSSLTGPGGLGGS
VHYATMARSAVRPASLNLNRSRSLSNSNPDISGTPTSPDDEVRSIIGSKVSSSNSVFGYT
CKFFYLSTFRAQ
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctatagtgaaccggcttcacaagtacctggacaccagccaggacatgcatggc
cgcaacagcttgctgtcctcttacatacactacgtcttccgattgcccagcactgacccc
aactcaccatcgccagaccccaactcatccttaacaggcccgggggggttgggaggttcg
gttcactatgccaccatggctcgctcagccgttcgaccagccagcctcaacctcaaccgc
tcccgtagccttagcaacagtaaccctgacatttccggtacacccacttctcctgatgat
gaggtccgctccatcattggcagcaaggtaagttcatcaaacagtgtctttggatatacc
tgtaagttcttttatctcagtacttttagagctcagtag

DBGET integrated database retrieval system