KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111649624
Entry
111649624         CDS       T06058                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00230  Purine metabolism
slal00240  Pyrimidine metabolism
slal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111649624
   00240 Pyrimidine metabolism
    111649624
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     111649624
SSDB
Motif
Pfam: dNK AAA_18 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 111649624
NCBI-ProteinID: XP_023255127
Position
Unknown
AA seq 176 aa
MSPVSHLSLQSYACLSRVRSQLQSPSVKLQQAENPVQFYERSVYSDRYVFASNLFECGNL
SDTEWAVYQDWHTWLLNQFEPEIALDGIIYLRAQPQRCMQRLLRRGREEEQGIPLEYLEQ
LHFRHEAWLYHRNLRLDFDYLNNLPLLILDVDDDFKNDRIKQEAIVDKVRAFLTML
NT seq 531 nt   +upstreamnt  +downstreamnt
atgtcacctgtctctcacctgtctctgcagagttatgcgtgtctcagcagagttcgttct
cagcttcagtctccgtcagtcaaacttcagcaggctgaaaaccctgttcagttctatgaa
cgctctgtttactcagacaggtacgtgtttgcgtccaacctgtttgagtgtggtaacctg
tcggacacagagtgggctgtttatcaggactggcacacctggttactgaaccagtttgaa
cctgagatcgccctcgacggaatcatctacctgagagcccagccacagcggtgtatgcag
cggttgctccggcggggacgggaggaggaacaagggattcctctggagtatcttgagcag
ctacacttcagacatgaggcctggctctaccacaggaacctcaggttggactttgattac
ctgaataatctacctcttctgattctggacgtcgacgacgacttcaagaatgatcgtatc
aaacaggaagccatcgtcgacaaggtcagagcctttctcaccatgctgtag

DBGET integrated database retrieval system