KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111649780
Entry
111649780         CDS       T06058                                 

Definition
(RefSeq) uncharacterized protein LOC111649780
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111649780
Transcription factors [BR:slal03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    111649780
SSDB
Motif
Pfam: PAS PAS_3 PAS_9 PAS_4
Other DBs
NCBI-GeneID: 111649780
NCBI-ProteinID: XP_023255245
Position
Unknown
AA seq 615 aa
SQDKSSRKHIIGTASTNPEPRKESLPLGNTVNESSLLLESLTGFALVVSSDGMVFYASST
IVDYLGFHQTDVMHQNVFDYIHIDDRQEFRRQLHWAMCPPQHQGTSAHQDNQLPAGTGED
FVVSSQFHSLEAGGIPPELSCFLNRCFIARVRCLLDSTSGFLTMQFQGRLKFLHGQKKKS
ASGALLPPQLALFCVAVPLLLPSITEMKMKNMLMRGKNKGGAGGGGIISALEHGERGEHL
RRHSFSGGMGDIADPLLLSCPTPGGTQRGHHTPWTPLSKDNLKYRPDGYYNQEEPLNYCK
SSMASHKGLSPGLGGGWPLRPNSGPLRAGQGMGYIPSNRVNKAGQYGKPYRLSPNYHSSR
GGEVFVSKLYGNVQIPTDPDAYCVDLVKSENGYGECYDGHLMPEMPPIKVEHDSDSENGC
DAYGRPWACRDPEAIDRRYGNGIYDQSSSLQLKSEADYYDPQYSPCQRGKAGISPPYNNG
NYHNYAVNNSGNTAARLLKCDKDMGNNNDNNQFSPQRLSHSDSLCSNQSVNLMDSQVYPQ
DPHKAYMQPDYNKHGTYEFKGHGLIHSIKREPMDSPPWSESGHDINQSMMVGPRNVMPCV
MSTGHHKSSPYIYMQ
NT seq 1850 nt   +upstreamnt  +downstreamnt
caagccaagataagagctccaggaagcatatcatcggcacagcatccactaaccctgaac
ccaggaaagagagtcttccactgggcaacactgtcaatgaaagcagcctcctcctggaat
ctctgacaggctttgccttggtggtgagcagtgatgggatggtcttttatgcctcctcga
ccattgtggattatctgggatttcatcagactgacgtgatgcaccagaatgtgtttgact
acatccacatagacgaccgtcaggagttcagacgccagctccactgggccatgtgtcctc
cacagcaccagggaacatctgcccaccaggataaccagttacctgcagggactggtgagg
actttgtagtcagcagccagtttcactctctggaggcagggggaattcctcctgagctct
cctgctttcttaacagatgtttcatagccagagtccgatgcctcttggacagcacctctg
gattcttgactatgcagttccagggtcgactgaagttcctccatgggcagaagaagaagt
cagcctctggggctctgctgcctccccagctggcactgttctgtgtagctgtacccctcc
tactgccctccatcactgagatgaaaatgaagaacatgctaatgcggggaaagaacaagg
gaggagcaggaggaggagggattatctctgcactggagcatggtgagcgaggggagcacc
ttcggaggcactccttcagtgggggaatgggtgacatagcagaccctctcctcctctcat
gtcccactcctggtggtacccagcgaggtcaccacactccctggaccccgctctccaaag
ataacctcaagtaccgccctgatggatactacaaccaggaggagcccctaaactactgta
agtcctccatggcttcccataaaggcctcagtccaggcctgggtggcggctggcccctgc
ggccaaactcaggtcccctcagagcgggccagggtatgggctacatcccctctaaccgcg
tgaacaaggccggtcagtacgggaagccataccgcctttccccaaactaccacagcagca
gaggtggcgaggtgtttgtgtctaagctctatgggaatgtccagattccaacagacccgg
atgcgtactgcgtggacctggtgaagagcgagaacggctatggagaatgctatgatggcc
atctaatgcccgagatgccccccatcaaggtagagcatgactcagactctgaaaatggct
gcgatgcctatgggcgaccctgggcttgccgcgacccagaagccatcgaccgtcgctatg
gtaatgggatatacgaccaaagctccagcctgcagctgaaatcagaagcagattattatg
atccgcagtactcgccctgtcagcgagggaaagcaggcatcagcccaccgtacaacaacg
gcaactatcacaactatgcagtcaacaacagcgggaatacggcagcacgtctgttaaagt
gcgacaaagacatgggaaataacaatgacaacaaccagttcagtcctcagagactctccc
attcagactctctatgcagcaaccaatccgtcaacctcatggactcacaggtctacccac
aggaccctcacaaggcctacatgcagccggattacaacaagcatggcacttatgagttca
aaggtcatggcctgatccattcaatcaaacgggagcccatggactccccaccgtggtctg
agagcggtcatgacataaaccagtccatgatggttgggccaaggaacgttatgccatgtg
tgatgagcacaggccaccacaagtccagtccttacatttatatgcagtaa

DBGET integrated database retrieval system