KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111649993
Entry
111649993         CDS       T06058                                 

Gene name
mecom
Definition
(RefSeq) MDS1 and EVI1 complex locus protein EVI1 isoform X1
  KO
K04462  ecotropic virus integration site 1 protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111649993 (mecom)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:slal03000]
    111649993 (mecom)
Transcription factors [BR:slal03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    111649993 (mecom)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-H2C2_5 zf-C2H2_8 zf-BED PyrI_C
Other DBs
NCBI-GeneID: 111649993
NCBI-ProteinID: XP_023255485
Position
Unknown
AA seq 1081 aa
MKAEEYSCDTMAPDIHEERQYRCEDCDQHFESRNQLLDHQKQPCGMPPSSFLNPGGDSDL
KAQEPQDLRPLHMSHGLHECKECDQVFPDVQSLEAHVLSHSEEREYKCDQCPKAFNWKSN
LIRHQMSHDSGKHYECENCSKQVFTDPSNLQRHIRSQHVGARAHACSDCGKTFATSSGLK
QHKHIHSSVKPFMCKSLRPYLCEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFST
TSSLNKHRRFCEGKNHFTAGGLFAQGMPLPGAPGLDKSALAMGHSSAGLADYFGASRHHG
GLTFPAAPAFPFSFPGLFPSGLYHRPPLIPATTSPVRQPSHAPITGPGAELSKSPLLPPS
PGTQETRELLKALRKDGGSPGSQMPSSELHTQSSSSSTKQRNKQSDQSESSDLDDVSTPS
GSDLESTSGSELESDMDSERERGAARENGKGPKRKASEGGPQSPSLTGSSAAKDFPGPSL
IPSSLDEHTAVTGAVNDSIKAIASIAEKYFGSTGLAGLQDKKVGSLPYPSMFPLPFFPAF
SPPVYPFPDRDLRPPGLKGEPQSPADDGKKAQGKSSAESPFDLTTKRKEEKSAPFTPSKP
EASHSVGQDQPLDLSLGTRGRGRHPREEETKKNLNYEEEKGVVEIPKADTSLQHARPTPF
FMDPIYSRVEKRRMSDPFETLKDKYMRPAPGFLFHPQFRLPDQRTWMSAIENMAEKLETF
GSLKPESGDLLRSVPSMFDFRAPPSALPETLLRKGKERYTCRYCGKIFPRSANLTRHLRT
HTGEQPYRCKYCDRSFSISSNLQRHIRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHEN
GNLSGTAMSSPQSELDSSSAILDDKEDSYFNEIRNFIGNTGQNQTSPDPSEEGLNGGPFE
EEKPLMASHVSRDLEDEEAEELGADEEEGEEPSNTPGKPEGEVLPSNLSDDIIQDEMDFT
GPNDLNLNCKTSPRGYKDEEEQSGYSALDHIRHFSDMRKLEESELSEGDGDEDDGSFGSP
SLNEAVKQPLFRKSKSQAYAMMLSLAEKDSLHPATHTPATMWHSLARAAAESSAIQSLSH
V
NT seq 3246 nt   +upstreamnt  +downstreamnt
atgaaggctgaagagtattcatgtgacaccatggctcctgatattcatgaggagaggcag
taccgctgtgaggactgtgaccagcactttgagtcccgcaaccagctgctggatcaccag
aagcagccatgtgggatgcccccctcctctttccttaacccaggtggggacagtgaccta
aaggcccaggaacctcaagacttgcgacccctccacatgtcccatggtctacacgagtgt
aaggagtgtgaccaggtctttcctgacgtccagagcctggaggcccatgttctgtcccac
tctgaggagagggaatataagtgtgaccagtgccccaaggccttcaactggaaatcaaac
ctgatccgacatcagatgtcacatgacagtggcaagcactacgaatgtgaaaactgctca
aagcaggtgttcacagaccccagtaacctgcagaggcacatccgctcacagcacgtcggg
gcacgggcccacgcctgctccgactgcggcaagacgttcgctacgtcttcgggcctcaag
cagcataagcacatccacagcagtgtcaagcccttcatgtgtaagtcactaagaccctac
ctatgcgaggtatgccacaagtcctacacccagttttctaacctgtgtcgtcacaaacgc
atgcacgctgactgccgcacacagatcaagtgcaaggactgtgggcagatgttcagcacc
acgtcctccctcaacaagcaccggcgcttctgtgaaggaaagaaccatttcacagcaggg
ggcttgtttgcccagggtatgccactccctggggcccctggcttggacaaatcagctctg
gcgatgggccacagcagtgctggactggctgattactttggggccagtcgccaccatggc
gggcttaccttccctgctgccccagcatttcctttcagcttccctggcctcttcccctct
ggactctaccaccggccaccgctcattcctgccaccacctctcccgtcagacaaccgtcc
catgcacccattaccgggcctggtgcagagctaagtaagagtcccctgctgcctccgagc
cctggcactcaggagacccgagagctcctcaaagctctccgtaaagatggcggttcacct
ggcagtcagatgccaagctcagagctccacactcagagctcctcatcctccacaaagcag
cgaaacaagcagagtgaccagtctgagagcagcgacctggatgatgtcagcacgcccagc
ggcagcgatctggagagcacatcaggctccgagctggagagcgacatggacagtgagagg
gagaggggggctgctcgagaaaatggcaaaggccccaagaggaaggccagcgagggaggc
ccccagagccccagcctgacgggcagcagtgctgctaaagactttccaggcccttccctc
atcccatcctcgctggacgagcacacagctgtaacaggggctgtgaatgactctattaag
gccattgcctccattgctgagaagtactttggctccacagggctggctggcctacaggac
aagaaggtcgggtctctgccctatccctccatgttcccactgcctttcttcccagctttc
tctcctccagtttaccctttcccagacagggaccttagacctccaggcctgaagggcgag
ccacagtctccggcagatgacggtaagaaggcccagggaaaatcttcagccgagtcacca
tttgacctcactaccaagcgaaaggaggaaaagtcagccccattcactccctccaaacca
gaggcctcccactctgttggtcaggatcagccgctagacctgagcctcggcaccaggggc
cgtggacgccatccaagagaggaggagacaaagaagaacctgaattatgaagaggagaag
ggagtggtggagatcccaaaggcagacacctccttacagcatgccaggcccacccctttc
ttcatggaccctatctacagcagggttgagaagaggagaatgagcgatccgtttgagact
ctgaaagacaagtacatgcggccagctccaggcttcctcttccatccacagtttcgtttg
ccagatcagagaacttggatgtcggccatcgagaacatggcagagaagctggagacgttt
ggctccttgaagccggagtctggcgacctgctgcgctccgtcccgtccatgtttgatttc
agagccccaccctctgcacttccagagacgctgctgcgcaaaggcaaggagcgctacaca
tgcagatattgtgggaaaatattcccgcgctctgccaacctgacccgccacctcaggact
catacaggagagcaaccatataggtgtaaatactgcgaccgctccttcagcatctcctcc
aacctgcaacgtcacatccgcaacatccacaacaaggagaagcccttcaagtgccacttg
tgtgaccgttgcttcggtcagcagaccaacttggaccgtcacctcaagaagcatgagaat
ggcaacctgtcaggcactgcaatgtcgtcccctcagtctgaactggacagtagcagtgcc
atattggacgacaaagaagactcttattttaatgaaataagaaatttcatcggcaacacc
ggccagaaccagacatccccagacccgtctgaggaagggttaaatggcgggccatttgaa
gaagagaagcctctgatggccagccatgtgtcacgtgacctggaagacgaggaggcggag
gagcttggtgctgatgaagaagaaggggaggagcctagcaacacccctgggaaaccggaa
ggcgaggtgctcccaagcaaccttagtgatgacatcatacaagacgaaatggacttcact
gggccaaatgacttgaacctcaactgcaaaacctctcccagggggtataaggatgaggag
gagcagagcggctactcagccctggatcatattcgtcacttttcagacatgcgcaagctg
gaggaaagtgaactgagcgaaggagatggagatgaggacgacggatcatttggctccccc
tccctgaacgaggcagtcaaacagccactctttaggaaatctaagtctcaggcgtacgcc
atgatgctgtctctggctgaaaaggactctctccacccagccacccacaccccagccacc
atgtggcacagtctggcacgggctgctgctgaatccagcgcaatccagtccctcagccat
gtatga

DBGET integrated database retrieval system