KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111650571Help
Entry
111650571         CDS       T06058                                 

Gene name
ak9
Definition
(RefSeq) adenylate kinase 9
  KO
K18533  adenylate/nucleoside-diphosphate kinase [EC:2.7.4.3 2.7.4.6]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00230  Purine metabolism
slal00240  Pyrimidine metabolism
slal01100  Metabolic pathways
Module
slal_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
slal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
slal_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111650571 (ak9)
   00240 Pyrimidine metabolism
    111650571 (ak9)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     111650571 (ak9)
    2.7.4.6  nucleoside-diphosphate kinase
     111650571 (ak9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 YHS AAA AAA_18 Cytidylate_kin AAA_33 FAP206 AAA_24 AAA_22 AAA_16 RNA_helicase AAA_14 SKI MMR_HSR1 ABC_tran AAA_28 Hydin_ADK AAA_5 Zeta_toxin NACHT NTPase_1 IstB_IS21 NB-ARC Ploopntkinase3 RsgA_GTPase ATP_bind_1 AAA_30 DNTTIP1_dimer dNK
Motif
Other DBs
NCBI-GeneID: 111650571
NCBI-ProteinID: XP_023256244
Position
Unknown
AA seq 1724 aa AA seqDB search
MDRLVDNLIEDEAERENLFAKPTCFIIVGRPGVGKSTLAKKIAQSWKCILIDDTDLLNTH
IKNKTKQGIELLNILSEGKSISEDNVLELILARLNSPDVEHYGYVLSCLPFMSEECLKIH
EQIELIKNLKLTPDFIINIKCADKDLAQRLSGLKQYPETGQLYNRDQWRRDEVYIDTKEN
KDEEVEDEEEKAVEEELQKDIIYQMVWIPENLDRNAFIRINMYKDTMLRPLEDYMTAHNP
IYLLELDGNNTPEQLHLSVMSRLGSMAIKRVSIPILLRQADDEELPEDVDTEDLLRIMSS
SREVAPGFRWRRSRWGRTCPVALKEGKIIPGKPEYSVGFQDKLYILSSQEACQKFVKNPR
RYLLPPMPRPPCRVSIIGPPQAGKSTLCKLLSQHYNTSVLDMEELVQPVLAKVEQERLDK
FKEETTQVAIDKIKMNMEQDSGQSSVTEDHPEVKVMVLNAMEEAKKLSTSPLGLYAEALA
NCIKEMEETDTDADVSTGWVLDNFPMNFSQMDALQQGEILPDILFCLKDSGGNQVLKRLY
EMNKESVDKAVRRRLQDEQSEKEKQVPNQKEQESEVLSNLETVDEETDENSKQSETTRPV
RPDIIKKEAVILPGHWELGYPGGPEMNDYKLQLQQFVSEWEQMQSALNVTCSVLEIDGKS
PEDLLQEMIFQMEKPFKYVPWELSALDLDEEAEDLEALAELERAEEGNSDNDAAEEDEGD
TTAKRLLGDTHHFCPVALKNQNVLLPCTEEIAAKYREKTFYFSSPEARDAFLQNPVQFVA
KTEPLKPPALRVFLLGPRGSGKTSNGEWLAQQLGLFHIQFREQLQMLIMAKTKKRVPHTD
EEESQEESPEDLEALIQEARGEGEEEEMEDTSANMNDMEQEVVLTDEEMAIKAYLSDGEP
LTPQILDMVIAPYWRQEPYMSTGFILEGFPHHPDEVQYMFQQQLFPDIVVIISVDVSDVQ
KRLLPTYLEKWRERRNHREAQLNLLRDLHKKNREENIVKRRAELMAEKGATAAKTKFRYQ
EAEEEDDEEEEEEEKAADNIEDEIEALLEEEFPSEEDNEDKENEETEEAAAERLEVEIEE
RFVTDENNLVTITELLSEQNIPNVSISASRKLQIVRQQLLRKMQPLLTNRESLFQKCQPI
SYSLAQRLLLSTYKLHSAFGCWDPIKQYKERDLIQPLQWPLNTTYPLIFHQYIYFFASKE
NRNTFMVNPLKYLRQSKPTPSLPVKMAVLGPPKSGKTAVAKMFAQKYGLVQLSIGSVMRM
VLNTQEHTDLAVQMKKHLSQGLVVPDELAIQCLEVALMSSVCSTQGYVLDGFPMTLKQAE
LMSSRSIIPMIVAELELDTVEVLKRGLEDKIKSNKPHLMHDSSEILHIRNSCYKQGVELV
KKHFQKQYQNWILLDGLKSKWWIWNSSIKEVSISMRYIHSYLDRVRSGQSACINRLCITP
KELHHRLGEFGHYCPVCLALHHHLGDCSEISVLINSAEYRGQYYKMCGENHLKRFLSTPD
QFVTPGCPNTLPEPHLLPRKLTEIQVKNRFPQQVEMKGFCPVTYLDGKQRYEALVRGKKE
YAVEYRERIYIFETKQKQDKFLRTPETYWDQRLPSKVPPLCEPVALTSLPTLGYLEQGVA
VAVIKAMTAVGCLKPKHPFLCIQRSALLYVAFYLKAFNHKSTDYTRQKYKKKLALFEENC
ALIPYLSSTMRGNYRPPSERPIDFEFKLNRFLALEVLPRANCVL
NT seq 5175 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtttagtggacaacctaatagaagatgaagctgagagagagaacctttttgcc
aaacccacctgcttcatcatagttggaagaccgggtgttggcaaatccaccttggccaaa
aaaattgcacagtcttggaaatgtatcttgattgatgatacagatctgctcaacacacac
ataaaaaataaaacaaagcaaggcatagagctcctaaatatcttatctgaggggaaaagt
atatcagaggacaatgtgctggagctgattcttgccaggcttaactcaccagatgtggaa
cactatggctatgtgctgagctgcctgccattcatgtcggaagagtgtctgaagattcat
gagcagattgaactgatcaaaaacctcaagctaacacctgatttcatcattaatatcaag
tgtgcagacaaggacctggcccagaggctgtcaggtttgaaacagtatccagagacaggg
cagctgtacaacagggaccagtggaggcgtgatgaggtgtacatcgacacgaaagagaac
aaggatgaggaagtggaggatgaagaggagaaggctgttgaagaggaactccagaaggat
attatttatcagatggtgtggataccagagaatctggacagaaatgcttttatcagaatc
aacatgtacaaggataccatgctcagaccactggaggactacatgacagcccacaacccc
atctacttgttggagctggatggaaacaacacacctgaacagctacacttgtctgtaatg
tcccgtcttggatccatggcaataaagcgtgtctccattcccatactcctccgccaggct
gatgacgaagaattgccagaagatgttgacacggaggacctgctgagaattatgtcgtct
tccagggaagtggcccctggctttaggtggagaaggagccgctggggccgaacctgtcct
gttgctctgaaggagggcaagatcattcctggcaagcctgaatattctgtaggcttccag
gacaaactgtacatcctctcatctcaagaggcctgccagaagtttgtcaaaaaccccagg
cggtatttacttcctccaatgcccaggcccccttgtcgggtttccatcattgggccccct
caagcaggaaagagcaccctatgtaagcttctatcccagcactacaacacatcagtgctt
gacatggaggaactggtgcagccagttctggccaaggttgaacaggagaggcttgacaaa
ttcaaagaggagactacacaggtcgctatagacaaaatcaagatgaacatggagcaggat
agtggacagagttcagtgacagaggatcatccagaggtgaaggtcatggtgcttaatgca
atggaggaagccaaaaaactgagcacatctccccttggcctgtatgctgaggcactggcc
aactgtataaaagagatggaagagacagacacagatgcagacgtcagtactggctgggtg
cttgacaactttcccatgaacttctcccaaatggatgccttacagcaaggtgaaatcctg
ccagacatcctcttttgtctcaaagacagtggtggaaatcaagttttgaagagattgtat
gagatgaacaaggagagcgtggacaaagcagtaaggaggaggttgcaggacgaacagtct
gagaaggagaaacaggtcccaaaccaaaaggagcaagaatcagaggtgctttcaaatcta
gaaacagtagatgaggaaactgatgaaaattctaagcaatctgaaaccaccaggcctgta
cgtcctgacataatcaaaaaggaagctgtaatactacctggtcattgggagttgggttat
ccaggtggcccagagatgaatgactataaactgcaactgcaacagtttgtgtctgaatgg
gaacaaatgcagtcagctctaaatgttacctgctcagtactggagattgatggcaaaagc
cctgaggatttgcttcaagagatgatctttcagatggaaaagcccttcaagtatgtgccc
tgggagctgtcagcgttggatctggacgaggaggcagaggatttggaggccctagcagag
cttgagagagcagaggaaggcaacagtgataatgatgcagcagaggaggatgaaggggac
acaacagccaagagattattaggtgatactcatcatttctgccctgtggccttaaaaaat
caaaacgtcctgttgccctgtacggaggaaattgcagccaagtaccgcgagaagaccttc
tacttctccagcccagaagcaagagacgccttccttcaaaatcctgtacaatttgttgca
aagactgagcctctcaagcctcctgccctgcgagtctttttgcttggcccccgtgggtca
ggcaagacctctaatggtgagtggctcgcccagcagcttggtctcttccatattcagttc
agggagcagctccaaatgctcatcatggccaagacaaagaagcgagtgcctcatactgat
gaggaagagtctcaagaggagtctcctgaggacttggaggccctgatacaagaagccagg
ggggagggcgaagaggaggagatggaagatacctctgccaatatgaatgacatggagcag
gaagtggtactgactgatgaggaaatggccatcaaagcctacctctctgatggagaacct
ctgactccacagattctggacatggttattgcaccatactggagacaagaaccatacatg
tccacaggttttattttggagggcttcccccatcatcctgatgaggtgcagtacatgttt
cagcaacagcttttccctgacattgtggtaatcatatcggtagatgtcagtgatgttcag
aaacgtctgttgccgacatacctggagaagtggcgtgagcgtcgtaaccaccgtgaagca
cagctgaacctacttcgcgatctgcataagaaaaaccgggaggagaacattgtcaagaga
agggctgagctcatggcagagaaaggtgctacggcagccaaaacaaagtttaggtatcaa
gaggctgaggaggaggacgatgaggaggaagaagaggaggaaaaagctgcagacaacata
gaggatgagatagaggccttgctggaggaggagtttccctcagaagaggataacgaagac
aaagagaacgaggagactgaggaagctgctgctgagaggctcgaagtggagatagaagag
cgatttgtgacagatgaaaacaaccttgttactataacggagctgttgagtgagcaaaac
atacccaatgtctcaatcagtgcatctcgcaagcttcaaatcgtccggcagcagctgctc
aggaaaatgcagcctctgctgactaacagggagtcactcttccaaaaatgtcaacccatc
tcatacagcctggcacagaggctgctgctctccacttacaagttacacagtgcctttggc
tgctgggatcccatcaagcaatacaaggagagagacttaatccagcccctgcagtggcct
ctcaataccacatatcccctgatcttccatcagtatatctacttctttgcatctaaggag
aaccgcaacacatttatggtcaaccctttaaagtaccttaggcagtccaagcccacccca
tccctccctgttaagatggccgtccttggaccacccaaatctggtaaaacggctgtggca
aaaatgtttgctcaaaaatatggcttggtacagctgtccattggcagtgttatgcgtatg
gtgctcaacactcaggagcacactgatctggctgtccagatgaaaaagcacctctcccag
ggccttgttgtacccgatgaactggccattcagtgtctggaggtggcgctcatgagctcg
gtctgcagcactcaagggtacgtgttggatggctttccgatgacacttaagcaggcagag
ctcatgagttctcggagcatcatccccatgatagtcgctgagcttgagctggacacagtg
gaggtgctgaagagaggccttgaggacaagataaagtccaacaagcctcacctgatgcat
gacagctctgagatcctccacattcgtaactcatgttacaagcagggggtggagctggtg
aagaaacacttccagaaacaatatcagaactggattctgcttgatggcttgaagagcaaa
tggtggatctggaacagtagtataaaagaagtcagtatcagcatgagatacatccacagt
tacctggatagggtacgcagcggtcagtcagcctgcatcaacaggctgtgcatcacacca
aaggagctgcaccatcggcttggagagtttggccattactgcccagtctgcctagctcta
catcaccacctgggagactgctcagaaatttcagttctgattaattcagctgagtacagg
ggacaatattacaagatgtgtggcgaaaaccatttaaagaggttcctgtccactccagat
caatttgtgactcctggctgcccaaacactctcccagagccccacctgctcccaagaaag
ctaactgagattcaggtgaagaacaggttcccacagcaagttgagatgaagggcttttgt
cccgttacttacctggatggaaaacaaaggtatgaagccctggttcgaggaaaaaaggaa
tatgctgtggaatacagagagcggatctacatttttgagacaaagcagaaacaggacaag
tttttgaggactcctgaaacctactgggaccagaggctgcccagtaaagttcctcctctt
tgtgagcctgtagccctcacctccctcccaacgttgggttacttggagcagggtgtggca
gtagcagtcatcaaggccatgacagctgttgggtgtctcaaaccaaagcatcccttcctc
tgtatacaaagatcagcactcctgtatgtggccttctatctgaaagctttcaaccacaag
agcacagactacactcgccagaagtacaaaaaaaagctggccttgtttgaagagaactgt
gcgctcattccctacctgagctcaacaatgagagggaactacaggccccccagtgaacgt
cccattgactttgagttcaaacttaacaggttcctggccttggaagtcttgccaagagcc
aactgtgtgctgtaa

DBGET integrated database retrieval system