KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652225Help
Entry
111652225         CDS       T06058                                 

Gene name
fancd2
Definition
(RefSeq) Fanconi anemia group D2 protein
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 CCDC53 SPAN-X
Motif
Other DBs
NCBI-GeneID: 111652225
NCBI-ProteinID: XP_023258204
Position
Unknown
AA seq 1164 aa AA seqDB search
MMRKKRRSSVDKGEGATSTTKAKKSRSTGRQRKEAAPEETNESVFSVFLREAGVTLKKGG
TSNEIAVDQVVFQKRIQQQLRKSPRYPGIVQEFITGLESHIEDHERFRNCLLPCVPQLPD
GDARSVSSFQESLLRMLLGIEMLQTPIINTLLEKLPEFMLDGTGDGGLSIPRIIINQLKW
LDRVVDSKELASKLMELVSVAPVDVQRDIITSLPEILEDSQHNDIARELNILLQTDTQLT
VPVLDALSSLNLSSSLLTEVRGAVMATLAAVQLEDLPVVVKFILHSVSASDAYEVVNNLR
KKLELEQCVLPPVLQASQSRMKSKGGAVSASTPAAGSSVTLILDGIKSAVRFQKSISEAW
VKAIESVDEAENHKVIDLLVLFILHSTNANQSRRGAEKVLKAKVRTGLIQDTLLQRTFRD
YSQVMRGYFPSILALAQSLLRSPDPGVVPFGGHMYQLSFTVFESYCQQVGCPLILTDMDV
IEKIESLSKAEREFLCNLLFHTINWFREVVNAFCRQKETELKMKVMTRLQNITYVQTLLE
RALAGTPGYVPPVANFDGESTDGLILSSAAPVNKAKKDGTGKKRKAPSKSSSEGSSQLDE
TTEADETLQEQPEKEKEKEVRQGVSLMSYRQFFRELDMEVLSVLQCGLLSRSLLDSELHS
KVQEEVMLGPAELVFLLEDMLRKVEFSLRAAPAKRAPFLKGRTDKSVGFSHLQQRSSKDI
ASYCVQLLPALCSHLEDCHNHFQTLLSENNGVVDGPATDVQEHQLMSYSYQLLLQILNTT
FCWSGFSLPGQRSLLKKALGVLAERLKEQRPDLTLEQLVKHSFEYLLNFRSTMPSLSTAL
CLSQLLSTVSAKGGNSATYREQAASLAKRFLSQEWVTASGEKERGNKFNEALQTLLSIYL
EHVDDVLKAVEEIAGEGIPELLNASKDESSASWPTLNRQTFLVFYKVMMAELEKAIRKIP
AGKISDNSEAQSEKLLTWNLAVRDFHILVNLVKVFDSRPVLNVCLKYGRLFLESFLKLGM
PLLDYSFKRHKEDVQSLLKTFQLSTRQLHHMCGHSKIQQDTSLTNHVPALKKSLELFLYR
VKAMLMLNNCQEAFWMGNLKNRNLKGEEILSQRSSDDEEEEEQHSLLPQEQSEDEAQESD
SEESKKINIEEDVDPDDITDDSDD
NT seq 3495 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggaaaaagcgacgctcctctgtggataaaggagagggagcgacctcaaccaca
aaggcaaagaaaagtcgcagcactggtcgccagcgcaaggaagctgctccagaagagacg
aatgaaagtgtatttagcgtatttctgagagaggcaggtgtcaccttgaaaaaaggtggc
acatccaacgagatagctgttgaccaagtagttttccaaaaaaggatacagcaacaacta
aggaagagtcccaggtaccctggaattgtacaggaattcatcactggattggagtctcac
attgaggaccatgagcggtttaggaattgcctccttccatgtgttccacagttgcctgat
ggagacgccagatctgtcagctccttccaggaaagtctgctacgcatgctgctggggatt
gagatgttgcagactcccatcattaacaccttgcttgagaaactccctgaatttatgtta
gatggcactggagatggaggtctcagtattccacgcataattattaaccagctcaaatgg
ctagacagagttgtggacagcaaggagttggcatccaagctcatggagctggtgtcagta
gcaccagtagatgttcagcgtgacatcatcaccagtctgccagagatactggaagattcc
cagcacaatgacatagccagggagctcaacattttactgcagacggacacgcaattgact
gtccccgtactggatgccctctctagtttgaacctcagttcatcattgttgactgaggtt
cgtggagcagttatggccacgttggctgctgtgcaactggaggacctacctgtggttgtc
aagttcatcctgcattctgtctcagcctctgatgcatatgaggtggtgaataatctccgt
aagaagctggagctagagcagtgtgttctccctccagtgctgcaggcctctcagagccgc
atgaagagcaaaggaggagcagtgtccgcttcgacaccagcagctggcagcagcgttaca
ttgatactggatggcatcaagtcagcagtcagattccagaaatctatttctgaggcttgg
gtcaaggcaatagagtctgtggatgaagcagaaaaccataaggtaatagatttgctggtg
ctgttcatcctccactccaccaatgccaaccagagccgaaggggggcggagaaggtgctg
aaggccaaagtgaggactggactgatccaggatactctgctacagaggacttttagggac
tattctcaggtcatgcgtgggtatttcccctccatcctggctctggctcagagtctgttg
cgctctcctgaccccggtgtggtaccttttggtggacacatgtaccaactctcattcact
gtgtttgaatcttattgccaacaggtgggctgccctctgatcctaacagacatggatgta
atagagaaaattgagagcctgtcaaaagctgagagagagttcctctgtaatttgctcttt
cacaccataaactggttcagagaggtcgtaaatgcattttgtaggcagaaagaaactgag
ctgaagatgaaagtgatgactcgtctccagaacatcacctacgttcagacgctgttggag
agggctctggctgggacacctggctacgttccacctgttgctaactttgatggagaaagc
acagatggactaatacttagttcagctgctcctgtgaataaggcaaagaaagatggcaca
ggaaagaagcggaaggcccccagtaagagctcctcagaaggcagctctcagcttgacgag
acaacggaagcagatgaaactctgcaggaacagccagagaaggagaaagaaaaggaggtc
cggcaaggagtcagtctgatgtcctacaggcagtttttcagggagctggacatggaggtg
cttagtgtgctgcagtgtggcctgctgtctcgctcactgttggactctgagctccacagc
aaagtccaagaggaggtcatgctgggtcctgctgagctggtcttcctgctggaggatatg
cttcgcaaagtggagttcagtcttagagccgcccctgccaagagagcccctttcctcaag
ggaaggaccgataaaagtgtgggcttctcccatctacaacagaggagctccaaggatatt
gcttcctactgtgtccagctgctgcctgccctctgctcacacttagaggactgtcacaac
cattttcagacactgctgtctgagaacaacggtgttgtggatggacctgccacagatgtg
caggagcaccagttaatgtcatatagctaccagctgctcctccagatcctgaacaccacc
ttctgctggtctggattcagtcttccaggtcagcggagcttactgaagaaagccctggga
gttttggctgaacgactcaaagaacaacgtcctgatttgaccctggagcagcttgtaaaa
cacagctttgagtacctgctgaacttccgcagcaccatgccaagtctcagcacagcgctg
tgtctctcccagctgctgtccactgtgtcagcgaaaggaggcaactctgcgacttacaga
gagcaggccgcttccctagcaaaacgtttcctgagccaagaatgggtgacagccagcggg
gagaaggagcgagggaacaaattcaatgaagcacttcaaactctcctaagcatctacctg
gaacatgtggatgacgttctgaaggcagtggaggaaatagctggagaaggaatcccagag
ctcctcaacgcctccaaagatgagagctctgcatcgtggcccactctcaacaggcaaaca
ttcctggtattctacaaagtgatgatggcagaactggaaaaagccatcaggaagattcct
gctggcaaaatcagtgacaattctgaggctcagagtgagaagctgctgacatggaacctg
gctgtcagagactttcacatcctggtcaacctagttaaggtgtttgattctaggccggtg
ctcaacgtgtgcctaaagtacggccgccttttcttggagtctttcctgaagttggggatg
ccgctcctggactacagtttcaaaaggcacaaggaggatgtccagagcctactgaagacc
ttccagctcagcaccaggcagctccatcacatgtgtggacattctaagattcagcaggat
acaagcctgaccaaccacgtgccagcgttgaagaagagcctcgagctgtttttgtacaga
gtgaaggcaatgctgatgctcaacaactgtcaggaggcgttttggatgggcaacctgaag
aaccgcaacttgaagggtgaagagattctttctcagaggtcaagtgatgatgaagaggag
gaagagcaacattcactgctgcctcaggaacaatcagaggatgaggcccaggagagtgac
tctgaggaaagtaagaagattaacatagaggaagatgtggatccagatgatattacagat
gactctgatgactga

DBGET integrated database retrieval system