KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652623Help
Entry
111652623         CDS       T06058                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04260  Cardiac muscle contraction
slal04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111652623
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111652623
   04261 Adrenergic signaling in cardiomyocytes
    111652623
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:slal04040]
    111652623
Ion channels [BR:slal04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   111652623
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin
Motif
Other DBs
NCBI-GeneID: 111652623
NCBI-ProteinID: XP_023258722
Position
Unknown
AA seq 158 aa AA seqDB search
SANSGDPGQSDSKKSYSYGWSFYFGALSFIMAEMVGVLAVHMFIEKHRKLRAKSRTELIK
KSAFSRIPSYRYRFRRRSSVRSSEAPSRDASPLGKGGYTGPAASEMPMYTLNPREAGNAG
SKAGGGMGGLLNSEREFLQSSTLTKDYSKDPNRRTTPV
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
tcagctaactcgggcgacccgggccagagcgacagcaagaagtcctactcctatggctgg
tccttctactttggcgccctctccttcatcatggcagaaatggtaggcgtgctggccgtg
cacatgttcattgaaaagcaccgcaagctacgagcaaagtcccgcaccgagctcatcaag
aaatccgccttcagccgcatcccctcctatcgctaccgcttccggcgccgctccagcgtg
cgttcgtccgaggcccccagccgtgacgcctcacccctggggaaaggtggctacacgggg
cctgccgcctccgagatgcctatgtacacgctgaacccacgcgaggcgggcaacgccggc
agcaaagcaggtggcggcatgggcgggctgctcaactcagagagggagttcctccagagc
agcacgctcactaaagactacagcaaggaccccaaccgcaggaccacacctgtctga

DBGET integrated database retrieval system