KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652909Help
Entry
111652909         CDS       T06058                                 

Definition
(RefSeq) adenylate kinase 9-like
  KO
K18533  adenylate/nucleoside-diphosphate kinase [EC:2.7.4.3 2.7.4.6]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00230  Purine metabolism
slal00240  Pyrimidine metabolism
slal01100  Metabolic pathways
Module
slal_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
slal_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
slal_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111652909
   00240 Pyrimidine metabolism
    111652909
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.3  adenylate kinase
     111652909
    2.7.4.6  nucleoside-diphosphate kinase
     111652909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADK AAA_17 Hydin_ADK AAA Cytidylate_kin AAA_22
Motif
Other DBs
NCBI-GeneID: 111652909
NCBI-ProteinID: XP_023259073
Position
Unknown
AA seq 344 aa AA seqDB search
MVNPLKYLRQSKPTPSLPVKMAVLGPPKSGKTAVAKMFAQKYGLVQLSIGSVMRMVLNTQ
EHTDLAVQMKKHLSQGLVVPDELAIQCLEVALMSSVCSTQGYVLDGFPMTLKQAELMSSR
SIIPMIVAELELDTVEVLKRGLEDKIKSNKPHLMHDSSEILHIRNSCYKQGVELVKKHFQ
KQYQNWILLDGLKSKWWIWNSSIKEVSISMRYIHSYLDRVRSGQSACINRLCITPKELHH
RLGEFGHYCPVCLALHHHLGDCSEISVLINSAEYRGQYYKMCGENHLKRFLSTPDQFVTP
GCPNTLPEPHLLPRKLTEIQVKNRFPQQVEMKGFCPVTYLDGKQ
NT seq 1034 nt NT seq  +upstreamnt  +downstreamnt
atggtcaaccctttaaagtaccttaggcagtccaagcccaccccatccctccctgttaag
atggccgtccttggaccacccaaatctggtaaaacggctgtggcaaaaatgtttgctcaa
aaatatggcttggtacagctgtccattggcagtgttatgcgtatggtgctcaacactcag
gagcacactgatctggctgtccagatgaaaaagcacctctcccagggccttgttgtaccc
gatgaactggccattcagtgtctggaggtggcgctcatgagctcggtctgcagcactcaa
gggtacgtgttggatggctttccgatgacacttaagcaggcagagctcatgagttctcgg
agcatcatccccatgatagtcgctgagcttgagctggacacagtggaggtgctgaagaga
ggccttgaggacaagataaagtccaacaagcctcacctgatgcatgacagctctgagatc
ctccacattcgtaactcatgttacaagcagggggtggagctggtgaagaaacacttccag
aaacaatatcagaactggattctgcttgatggcttgaagagcaaatggtggatctggaac
agtagtataaaagaagtcagtatcagcatgagatacatccacagttacctggatagggta
cgcagcggtcagtcagcctgcatcaacaggctgtgcatcacaccaaaggagctgcaccat
cggcttggagagtttggccattactgcccagtctgcctagctctacatcaccacctggga
gactgctcagaaatttcagttctgattaattcagctgagtacaggggacaatattacaag
atgtgtggcgaaaaccatttaaagaggttcctgtccactccagatcaatttgtgactcct
ggctgcccaaacactctcccagagccccacctgctcccaagaaagctaactgagattcag
gtgaagaacaggttcccacagcaagttgagatgaagggcttttgtcccgttacttacctg
gatggaaaacaaag

DBGET integrated database retrieval system