KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111652994Help
Entry
111652994         CDS       T06058                                 

Definition
(RefSeq) titin homolog
  KO
K12567  titin [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111652994
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111652994
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:slal04812]
    111652994
   04147 Exosome [BR:slal04147]
    111652994
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111652994
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111652994
Membrane trafficking [BR:slal04131]
 Others
  Actin-binding proteins
   Others
    111652994
Cytoskeleton proteins [BR:slal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111652994
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111652994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 ig Ig_2 V-set Ig_6 Adeno_E3_CR1 Ig_C17orf99 Herpes_gE
Motif
Other DBs
NCBI-GeneID: 111652994
NCBI-ProteinID: XP_023259195
Position
Unknown
AA seq 2733 aa AA seqDB search
NFHRRRIKTSCRFLIKRIKSCVYSNKYELFYHESKEGTLHSSAEVTGARQLRGAFSDTED
FLDHGLVSANRCSSRTSSITSWTDNIKPSFTKKLKFQSVLEGEAVELKCKLVACPPPTIL
WFHNNRSIPKERRRRICSDSKMHMHTTSLVIDSIKEKDSGSYKVMAINTEGSAESTASLL
VSLREEQSANYLGFVKRSAKAHESIDTMAEQRKDRKIRVELRCVGSPFDKMSKVHQGRSR
SKNSLVRTVYFRSGSHSKEKVSEKESKRLETASERAPSPPLMFDRSERFNDRFSDIYCDR
RTGARFSDKFSDRCSDRYSERFSDTESLHNEVRTKLTTLQKAVKQKKRLSICTMSSSEFE
LESVASESSYADYVERLRVKPASLPDVQHFNRTLDVGESHREFQGKTSSGDPSQPRVRHS
FEPQSRTRAIQIMRGELVDTLLEPTERKSGEKYSQSLEGKDVDENQADVRMMQRHSVVAD
HKVDAEKPEAPYSETTAYPGTAAYTESREHLVTSTREKFLRGSLTPEEKTETVEPYEEES
AGESLRAQYEKSLEAERMECEEKLLALRIRKWQQGSRASEEETFHPDTDLPMPSETQYME
PEGHIYTQQEMIEKRAIVETEAMPSSFRKSPRMKARLVDPEFAIASTPKSPKVKARGEVE
TSLSLPAKSATMDTRLAKTEGEASPMQVQKSPRIKARATEVEAELSPRTKTRAEDVLRET
PRPRPERSSPLGLATETVEPYEEESAGESLRAQYERSLEADRMECEEKLLALRIRKWQQG
MQISEEETFHPETDLPLVAETQFMAPEGNVYTQQEVGEKRESHATTSTPKSPKVKSRVEQ
DEITVMLSQKSPRIKARAEEEKAESSPRTKPRTEKMLFEKTREERELQLSRENISELKNE
SEKFVSEEEALTQRIMKWQQDVLMEQEQAVKLESDWVEGYSPLQAERTSEVGRNVAEASA
LESIPQNEVVRSRKTSPGKTAKEKFLSSESVPAGFQDQQGETLQWPPAGELPTEGRETRL
QRDSEYFVSEEEALAQRILKWQQDVVEQEEVAELESEWALDSQSKQSGSRLPFETISPFD
SEPYHGGISHEIDPTDPRSPHTSLAGEALPTKKPSPPAAGCEPSPHESSFITRYSPTHPA
LPHHAGAPVERSYDLKTTPLKDTMGLEASPVQRYSPTQFTSAPQGESPHKPSQEFSSVRR
RSPCRRPQESVEKATERRWSREEYSMSADKSSSQRFQSDMRGERGMREELGSTRETSEWR
QQKGFAGVRREERHEDLLRSQQGDEMSAEIHELGATRKKEDRVQEESNFKEGVYQSQESK
TVKEGVTSARGSRPVFVKEMSSVKVKIGEMSEFTCQFNGDPLPTVTWLKDGHPLAHNFDY
DIISKSNKSTLTIFYPTTDHEGTYDCVITNKHGKSICTATLEISDKKVVRRTGATQEVVV
TEEIDKGEENQESLMEEELQSYMESGKATLQVPQAVIHRRHCSDESFSSSAVEIRITAPT
PVPEMTEENTDDKPQAFTENPSGVPSDEGASQTVKHKFTFSFDVVGEAPHVISELENITC
SEDNTAVLECVITGEPAAEVEWYCNDIRLELTGGKYRVEVDDKVYRLYINSFTYTDAGVY
KCVARNRLGEVTSISDVSFQVEEPVQFSKRGGVVEDDVFHKAGITYTKSLPQAPSEVAAK
AIKSRPSVSREPPALSGCGLQASAAVIKVSKIKQAFESDSPVALMTPTSPEEQRIETFFP
EEFIPVVASSPDTQEQIIAPKPLPDGTQTIPVGSKSVSSKTSQFTSPREEGSDICVVPCD
VEEGAVFEESHSAVKQFVEDVKESPELVRPKPQKPVCLPVQGEAGEGEMVREGTVPTQFD
RSSSFIQFQSEKVPAVKRSVRTSALAEEVVKPKRISESFKPDKQSAPARPEIVSGASVVE
GLTEVEKQDVKGSTEGYALMSGLQHMSDELELAGEELISIPELSLDKHARSEQISIPEPS
LDSGVFLSMPDSQADVIKVAEGMVADDVVDPHIQIMGEDGHVKAEHKPLIVKPKVDMVGR
IKPLSLPVDAVVQGQERRSSDRASAAEAGVAAAAVSPMEEEEVTFSAVYDYYNPPTDWGR
PLSPESEMSIEIGSTLSEEIAEVAERFYTPGSSTEVSQPIAESFHTPKSPMSFHTPSSDA
PGGFMTPQEYPFSPVEHQRPSTGISSERFFSPLQFLTSPADEGIETTPLGINVDENQFLT
RGRGSTGLQEKVQGIPPAFLKPLIKKRVFENDSLTFCAEVFGLPSPDVKWFCNKTQLVAD
DRVKMERDGDTISLTIHNVTKADQGEYICEAVNYVGEARSVALVVVVSQEVRFMPAPPAV
THQHVMEFDVEEDDSSRSPSPQEILLEVELDENEVKEFEKQVKIITIPEYTADNKSMIIS
LDVLPSIYEEGAVDFVTQEHDELKIAFEVTEMPPRFINPICDMEAPEGTTVMFECSLMGI
PSPIVSWFKGDKKVPHNNKKYLHSSDGDNHFLKICKVSTQDSGVYTCRAINVVGETLCRA
SVVVLSAKTFSGKTRGRELTAVSLGSAKVQPQKFDLMVGNTSFDGEQVSEIELEFEFEQE
ADESQRAVRLVANTDNEMSEQGEKYVSINFDVFAEPAKDDKVEFKGKSSDMCSFQFQVTE
TAPKCVIPLTNVTAAVGTPVILQCLVSGKPNPTAEWYKDGDRVADSRCIIQEKTTGHFNL
LITNVTQSDAGEYKCIIQNTAGCVETTALLKVF
NT seq 8203 nt NT seq  +upstreamnt  +downstreamnt
aaatttccacagacgaaggatcaaaacttcctgcaggtttctaataaaaagaatcaagtc
ttgcgtttattcgaacaaatatgagctgttttatcatgaaagcaaagaaggaacactgca
cagcagcgcagaggtcaccggtgctcgacagctgagaggagccttctccgacaccgagga
cttcctggatcatggcctggtgtcagccaatcgctgctccagcagaacctcctccatcac
ctcgtggacggacaacatcaaaccgtctttcaccaagaaactcaagttccaatccgtcct
ggagggggaagcagttgagttaaagtgtaaactagtcgcttgcccgccgcctactatcct
ctggtttcataataacagatctattcctaaagagcgtagacgtaggatctgctctgacag
caaaatgcacatgcacactaccagtctggttattgacagtatcaaagagaaggactcagg
cagttataaggtcatggcaataaacacagagggttctgccgagtccacagcatcactttt
ggtgtcactgagggaagagcagtccgccaactacctgggctttgttaaacgctctgccaa
agcccatgaaagcatagacaccatggcagagcagaggaaagataggaagattagagttga
gctcaggtgtgttggctctccatttgacaagatgtccaaagtccatcagggaagatctcg
gtctaagaactctttggtgcgtactgtgtactttcggtctggttcccattcaaaagagaa
agtgtcagagaaagagtctaaacgtttggaaactgcctctgagcgtgccccgtcccctcc
cctcatgtttgacaggtctgagcgctttaatgacagattcagtgatatttactgtgaccg
gcgcaccggtgctaggttcagtgacaaatttagcgacaggtgcagcgacaggtacagcga
aagattcagcgacaccgagagccttcacaacgaggtaagaacaaaacttactacactcca
aaaagctgtaaaacagaagaagagactttctatctgtaccatgtcgtcgtctgagtttga
gttagaatcagttgccagtgagtccagctatgctgattatgttgagaggctcagagtgaa
gcctgcctcgctgcctgatgtccagcatttcaatcgaactttagatgtgggggagagcca
tagggagtttcaaggtaaaacctcaagcggggatccctctcagcctcgtgtgaggcattc
atttgagcctcagtccagaaccagggccattcagatcatgagaggtgagttggttgatac
actgctggaacccacagagagaaaatcaggtgaaaaatattctcagtcactggagggtaa
agatgttgatgaaaatcaggcagatgtgagaatgatgcagcgtcacagtgttgttgctga
ccacaaggtggacgctgaaaagcctgaagccccatactctgaaacaacagcatatccagg
aactgcagcgtacactgaaagcagggaacatctcgtcacatctaccagggagaagttcct
tagaggatcacttacaccagaagaaaaaacagaaacagtagagccgtatgaagaggagag
tgcaggggagtctttgagggctcagtatgagaagagcctggaagctgaacggatggagtg
tgaggagaaacttctcgccttgcggatcaggaaatggcagcaaggaagtagggcatcaga
ggaggagacatttcaccctgacactgatctgcccatgccatcagagacacagtacatgga
gcctgaggggcacatttacacccaacaggaaatgatagagaaaagagcaattgttgaaac
tgaggccatgccctcctcgttccgtaaatcaccaagaatgaaggcaaggttggtagatcc
agagtttgcaattgcatcaacacccaagtcaccgaaagtaaaagccagaggagaagtgga
aacgtccctctccttgcctgcaaagtcagccacaatggataccagattagcaaaaacaga
aggtgaagcatcacccatgcaagtgcaaaaatcccccagaataaaagctagagctacaga
agtagaagcagagttgtcacccagaacaaaaaccagagcagaggacgtacttcgagagac
acccagaccacggccagaaagatcgtcaccactcggcttagcaacagaaacagttgagcc
atatgaagaggagagtgcaggggagtctttgagggctcagtatgagaggagcctagaagc
tgatcggatggagtgtgaggagaaactcctcgccctgcggatcaggaaatggcagcaagg
catgcaaatttcagaagaggagacattccaccctgaaactgatctgcctctggtggcaga
gactcagtttatggctcctgaggggaacgtttacacccagcaggaggtgggggagaaaag
agaaagccacgctaccacgtcaacccctaagtcacctaaagtaaaaagtagagtagaaca
ggatgaaatcacagtcatgttgtcacaaaagtcacccagaattaaagctagagcagaaga
agaaaaagctgagtcatcacctagaacgaaacccagaacagagaaaatgttgtttgagaa
aacaagagaagagcgtgagctccagctttcaagggagaacatctctgaactgaagaatga
gagtgagaagtttgtcagtgaagaggaggccttaactcagcggataatgaaatggcaaca
ggatgttctgatggaacaagagcaagctgtgaagctagagtcggactgggtggagggtta
ctcaccattacaggcagagagaacctctgaggttggaagaaatgttgcggaggcttctgc
tttagaatcaattccacaaaatgaagttgtgcgcagcagaaaaacttcaccaggtaaaac
ggccaaagagaagttcctttcaagtgagtcagtccctgctggtttccaagatcagcaggg
tgagaccctgcagtggccacctgctggcgagctgccaacagaggggcgtgaaactaggtt
gcaaagggacagcgagtactttgtaagtgaggaggaagcactggctcagcgcatcttgaa
atggcaacaagatgttgtcgaacaagaggaagtagctgaactggagtctgagtgggcttt
ggacagtcaaagcaaacagtctggctctaggttgccatttgagaccatctcaccatttga
tagtgaaccctatcatggtggcatatctcatgaaattgatcccactgaccctcgatctcc
acatacatcgcttgctggtgaagccttaccaacaaaaaaaccttcacctcctgccgctgg
gtgcgaaccatctcctcatgagtcttcttttataacgaggtattctcctacgcatcctgc
tttaccgcaccatgcaggtgcgcctgttgaaagatcctatgatttaaaaactactcctct
aaaagacaccatgggtcttgaagcttcaccggttcagagatactctccgacccaatttac
tagtgcacctcagggggagagtcctcataagccttcccaagaattttcctcagtcaggag
acgctccccatgccgtagaccacaagagtctgtggaaaaagcgacagagaggaggtggag
cagggaggaatacagtatgtctgctgataaatccagcagtcaacgcttccaatcagacat
gagaggggagagagggatgagagaggaattaggatctacgagagagaccagcgaatggag
acaacagaagggtttcgcaggtgtgaggagagaggaaagacatgaagatttgctaagatc
acaacagggtgatgagatgagtgctgaaattcatgaacttggagctacaaggaagaagga
ggatagagtccaagaggagtcaaatttcaaagagggagtttaccaaagtcaagagtctaa
gacggtaaaagaaggggttacaagtgccagaggctcccgtccagtatttgtgaaagaaat
gtcttcagttaaagtaaaaatcggtgagatgtcagagtttacttgccagttcaatggtga
ccctctgcccacagtcacttggctcaaagatggccacccattagcccacaactttgacta
tgatatcataagcaaatctaacaagtctacactcactatcttctatccaaccacagacca
cgaggggacatatgactgtgtcataactaataaacatggcaaatccatctgtaccgccac
tctcgagatctcagacaaaaaggtggtgagaaggacaggcgccacacaggaagtggtggt
tacagaagagatagacaagggtgaagaaaaccaagagagcctgatggaggaggaacttca
gtcctacatggagtcggggaaggcaacgctacaggtgcctcaggcagtgatccacaggcg
ccactgctcggatgaatctttcagctcctcagctgtagaaatcagaattactgctcccac
acctgtccctgagatgacagaggaaaatactgatgacaaacctcaggcttttacagagaa
cccttcgggcgtgccgagtgatgagggagcctctcagactgtcaaacataaattcacttt
ctcctttgatgtggtcggtgaagctcctcatgtcatcagcgaattagagaatatcacatg
ctctgaagacaacactgctgtattagagtgtgtcattacaggtgaacctgccgcagaagt
tgaatggtattgtaatgatattcgcctcgaactcacgggcgggaaatacagagttgaggt
agacgataaagtgtataggctgtatatcaacagttttacatacactgatgctggagtgta
caaatgtgttgctagaaataggttgggagaggtgacaagcatctctgatgtgtcatttca
agttgaagagcctgtgcagttttcaaagagaggtggtgttgttgaggatgatgtattcca
caaagctggcatcacttatactaagtctctcccccaagcgccttcagaggtagcagccaa
agccataaagtccagacctagtgtctctagagagcctccagctttatccggctgtggtct
gcaggcttctgctgctgtgataaaagtttctaagattaaacaagcttttgagtcagactc
tccagttgctttaatgactcccacctctccggaggagcagagaatagaaacatttttccc
tgaagagtttataccagtggtggccagttcccctgacacgcaggaacaaataattgcacc
taaacctctacctgatggcactcaaactattcctgtaggatccaaatctgtctcttctaa
gacctcacagtttacctcccccagggaggaaggcagtgacatctgtgtggtaccttgtga
tgttgaagagggggcagttttcgaggaaagccatagtgcagttaaacagtttgtagagga
tgttaaggagtctccagagctggtcaggcctaagccacagaaacctgtttgtttacctgt
acaaggggaggcaggtgaaggggagatggtaagagagggcactgtgcctacacagtttga
tagaagtagcagcttcatccaattccagtcagaaaaagttcctgcagtgaaacgctccgt
cagaacttcagctctagctgaggaggttgtaaagcctaaaagaatttctgaatctttcaa
acctgacaagcaaagtgcacctgcaaggcctgaaatcgttagtggggctagtgttgtgga
ggggttgacagaagtggaaaaacaagatgttaaaggaagtactgagggatacgctctcat
gtctgggttgcagcatatgagtgacgagttagaacttgcgggtgaggagttgatttcaat
cccagaactctctttggacaaacatgcaaggagcgagcagatttccattccagagccctc
tttggacagcggcgtcttcctcagtatgccggactcccaggctgatgtaataaaagtggc
agagggaatggtggctgatgacgtagttgaccctcatatacaaatcatgggtgaagatgg
ccatgtgaaggcagaacataaaccgcttattgtcaagcctaaagtagacatggttggaag
aattaaaccactcagtctgcctgtggatgctgttgtccagggacaggaaagacgtagttc
agacagggcctcagcagctgaagctggggtagcagcagcagcagttagccccatggagga
agaggaggtaactttcagtgctgtttacgactactacaaccctccaactgactggggaag
gccactgtcccctgagtctgagatgtccatagagattggcagcactttgagcgaagagat
agctgaggtagctgagaggttctacaccccaggctcgtctactgaggtctcacagccaat
tgcagagtccttccacactcccaagtctcccatgtccttccatactcccagttctgatgc
accaggtgggtttatgactcctcaagagtatcccttctcccctgtagaacaccagagacc
ctcgacaggaatctccagcgagaggttcttctcaccccttcaattcctgacatctcctgc
tgatgagggcattgaaacgacacctcttggaataaatgtggacgagaatcaattcctcac
caggggtagagggtctacaggcctacaggagaaagtgcagggaattcctcccgccttcct
caaacctctcattaagaagagagtctttgaaaatgactcgctaacattctgtgctgaggt
gtttggcctaccttcccctgatgtgaagtggttctgcaacaaaacccaactggtggcaga
tgacagagttaaaatggagagagatggcgataccatctcacttacaattcacaatgtcac
taaagcagaccagggagagtatatatgcgaggctgtgaactatgttggggaagccagaag
tgttgcattagtggtagttgtatcacaggaagtgaggttcatgcctgccccacctgctgt
cactcaccagcatgtgatggagtttgatgtggaggaagatgattcttctcgctctccatc
ccctcaggagattctgcttgaagtagaattggatgaaaacgaggtgaaagaatttgagaa
acaggttaagatcatcaccattcccgagtacacagctgacaacaagagcatgatcatatc
tttggatgtgttaccgagcatttatgaggagggtgctgtggactttgtcacccaggagca
tgatgagttgaaaatagcttttgaggtcactgagatgcctccaaggttcattaatcccat
ctgtgacatggaggccccagagggaaccacagtcatgtttgagtgctcactgatgggaat
tccatctcccattgtgtcctggttcaaaggtgacaaaaaagttcctcacaataacaagaa
atacttgcactcatccgatggagacaaccacttcctgaagatctgtaaagtgtcaacaca
ggatagcggagtgtatacctgcagagctattaacgttgttggggagactctgtgtagggc
ctccgtggtggtgttaagtgccaagactttctcagggaagactagaggcagggagttgac
cgctgtgtctcttggaagtgccaaagttcaaccacagaagttcgacttgatggttggcaa
cacatcgtttgatggtgaacaggtgtcagaaattgagcttgagtttgagtttgagcaaga
ggcagatgagtcgcagcgagcagtcagactggtggccaacactgacaacgaaatgagtga
acagggagaaaaatatgtaagcatcaattttgatgtgtttgctgaaccagcaaaagatga
taaggtagagttcaaagggaagtcctctgatatgtgtagcttccagttccaggtgactga
gacagcccctaaatgtgtcatcccactgaccaacgtcacagcagcagtagggacacctgt
tatcctccagtgtctggttagtggtaagccaaaccccaccgcagagtggtacaaagatgg
agatcgcgtcgcagacagcagatgtataatccaggagaaaaccacgggccatttcaatct
gctcattactaatgtgacccagagtgatgctggtgagtacaagtgcataatccaaaacac
agctgggtgcgttgaaactacagcactgctgaaggtgttttag

DBGET integrated database retrieval system