KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111654343
Entry
111654343         CDS       T06058                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3
  KO
K15195  AF4/FMR2 family member 3
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:slal03021]
    111654343 (aff3)
Transcription machinery [BR:slal03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111654343 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 111654343
NCBI-ProteinID: XP_023261085
Position
Unknown
AA seq 1238 aa
MPTVLGGKGKLSIVCFLLRCAYSQVTRSQHNSCAKDILEDMTQSWPSQQALGGDQAQRIL
YSPKDAKQPTTQQRQSRGDVQQRMTRHPHVAPHKSMLADDLKLSSDDDDTQRAIHESASW
DRHSLSAQRAHTHGRRVRHSSSDSSGSDSSAESGSSSFRSRSPSPDVHPDPASPANTQPL
CSNKENDHPSAAQWQLDKWLKKSRKKSASSEQDPSHSATGHLSSPHTQRAPSPARSWDSN
QEYSPSQSPIPSPQFNYSNNNSPLPSPGYSYCPSPSPFPSTCPSPSPSPRYSPIPSPVLS
VCPSPFGSPGGSCSPSPVPRDPPRSPSPSLSPPSRVRHYPEVQSQNQTQPSLTTNSHRKK
IRSRIPRLPNIDTKNKPTNSSHPPPTHQHRSRTQPSQDRDQSQSKSKATAVLNSNQSHNH
KSRPKSNFHLNSKQLSEAPKAKHALNFEQIQGSRSHHRSNHKPRPPFQPSSQHSPTRAKH
LVPASRETNAHSTHSQSTSKAATNSGSGLNSRASPSLKPRARLWEATASTPVNVNHTKSQ
KKTQNKEQQVDDRGVHLIQAEGRKHERKEDRHREKQQGKQERKEDKRLAEEQLLRRPWIQ
SSAEEEEEEEEEGALERQRRREETAKGETRRRREQQHRREWQTVQTKQRVSTNTKRHRLH
EDSQHQGRTKKGGKSEEERELQPDPSPSPSHSPTPHRPSSSCSSSSSSSTNSDSESEHQA
PITKVPADSTSHKRLARRGQQGPGRPDASRPKVVHSRGPISANPSEGQQSERKQKLYTLV
PFGRSDQATVSSQRGLRNLVVKIDLCLLKRVPDSTTTSTVKKPFSSPSSSSSTKDKQREA
MKHLYTPDTGTKDSKKKRKLENGESHRESKRSLPHASDLSGCTESSANTAECNIVTETTH
NGYLEEYLDSKRPLSPLSPLSNSPESTKPPSKTNTSEQHQIHTNKNRDKNRDSAVKPKME
VECVKVSRQPQPLCESWGLTGHRGTVPNHDTPHHAEYYLHEAKRMKHRADAMVDKLGKAV
NYVDAALSFMECGKAMEEGPLEAKSPYAMYSETVELIRYAMRLKSHSGPGARQEDKQLAV
LCFRCLALLYWQMFRLKKDHALKYSKVLLDYFKSSPKVPTTPPCWNDSGKGAGGPPSSLS
PNAKHLGRGSHGGSTSPSLISIPQRIHQMAANHLNITNSVLYSYEYWEVADNLAKENKEF
FNYLNTLSGPLTLHSSIAHTVQYTRQALQWIRISAKLN
NT seq 3717 nt   +upstreamnt  +downstreamnt
atgcctactgtcctcggtggcaaaggaaaactttccattgtctgttttctgctccgatgc
gcatattctcaggtaacaagaagccaacataacagttgtgccaaagatattctggaggac
atgactcagtcctggccgtcccagcaagccttagggggtgaccaggcccaacgaatcctc
tacagccctaaggatgcaaaacaaccaaccacacaacaaaggcaaagtcggggggatgtt
cagcagcgaatgacccgtcaccctcacgtggcaccgcacaaatccatgcttgctgatgac
ctgaagctgagcagtgatgatgatgacactcaaagggccattcatgagtcagcttcctgg
gatagacacagcctgtcagcacagcgagcgcacacacatggcaggcgggtgagacattcc
agctcggactcttcaggctcagactcctctgccgagtcaggcagcagtagctttcgttcc
cggagcccgagcccagacgttcacccagatcctgcatcgccagccaacacacagccactg
tgcagcaacaaggagaatgatcatccctctgctgcccagtggcagttagataaatggctg
aagaagtcccgcaaaaaatctgccagcagtgaacaagatccttcccacagcgctacagga
cacctgtcctctcctcacacccagcgagccccatctccagccagatcctgggacagcaat
caggaatacagccctagtcaaagccctattcccagcccacagttcaattacagtaacaac
aatagccccctgcctagccctggttacagctactgccctagccccagcccattccccagc
acctgtccaagtcccagccctagcccgaggtacagcccaatcccaagcccggttctaagt
gtttgccccagtccatttgggagcccaggaggcagctgcagcccgagccctgtccctaga
gaccctccaagaagcccaagtcccagcttatctcctccttcaagggttcgtcactaccct
gaggttcagagtcagaaccaaacgcaacctagcctaacgactaattcacacaggaaaaaa
attaggtcaaggattccccggttgcctaacatcgacaccaagaacaagcccacaaatagt
agtcatcctccgccaactcatcagcacaggtccaggactcaaccctcacaggaccgagac
caaagccaaagcaaatccaaggccactgctgttttaaactctaaccagagtcacaaccac
aaatctagacccaagtctaactttcatctgaattctaaacagctctcagaggctcccaaa
gccaaacacgcattaaattttgagcaaatccaggggagcagatcccaccacaggtccaac
cacaagcccaggcctccgtttcaacccagctcacaacatagccccacaagagcaaagcac
ttagttcctgctagtcgtgaaaccaatgcccacagtactcattcccaatctacctctaaa
gctgctactaattctggtagtgggttgaactctagggctagtcctagcctaaaacctagg
gccaggttgtgggaggctacagcgtcaactcctgtgaatgttaatcacacaaaatcacag
aagaaaacccaaaataaggaacagcaggtggacgacagaggagttcatctaatccaagca
gaggggagaaagcacgagagaaaagaggacagacatagggaaaaacagcaagggaaacag
gaaagaaaggaagacaagaggctggcggaggagcagctactgagacgtccctggatccag
agttcagcggaagaagaggaggaggaagaggaggagggagcactagaaaggcagaggagg
agagaggagacagcaaaaggggaaaccaggagaaggagggagcagcaacacagacgcgaa
tggcaaacagtccagaccaaacagagagtgtctaccaacaccaagcgacaccgccttcac
gaggactcacagcaccaagggaggacaaaaaagggagggaaaagtgaggaggagagagag
ttacagccagacccttcaccttcgccgtcacattccccaactcctcataggccatcctcc
tcatgctcatcctcttcttcttcctccacaaattcagattctgaatctgaacatcaggct
ccgatcaccaaagttccagcagattctacctcccacaagagactcgccaggagagggcaa
caaggcccaggcagacctgacgccagcaggccgaaggtggtgcactccagaggacctatt
tcggctaatccaagtgaggggcagcagagtgagaggaagcaaaaactctacaccctagtc
ccttttgggcgaagtgaccaggctacagtgtcttctcagcgagggcttagaaatctggtg
gtgaagatagacctctgccttctcaaaagggtccctgacagcactactacttccactgtt
aaaaaacctttttcctctccctcgtcctcttcatcaaccaaggacaaacaaagagaggct
atgaaacacttgtatacaccggacaccgggacaaaagacagcaaaaagaaacgcaagctt
gagaatggcgagtcacacagagaaagcaagaggagtcttcctcatgcaagtgatctctca
ggttgcacagagtcatcagctaacacagctgaatgcaacattgtgactgagaccacacac
aatgggtacttggaggagtatttagacagcaagaggccactgtctcccctgtctccactg
tccaacagccccgagtccaccaaacctccctccaaaacaaacacctcagagcagcatcaa
atccacaccaataagaacagagacaagaatagagattctgctgtaaagcccaagatggag
gtggaatgtgtaaaagtatcaagacagccccagcccttgtgcgagtcatggggtcttaca
ggacacagggggactgtgccgaaccatgacactccacaccatgctgagtactacttacat
gaggctaaacggatgaagcaccgtgccgatgcaatggtggacaagctggggaaggctgtg
aactacgttgacgctgctctctccttcatggaatgtgggaaagcaatggaggaaggccca
ctcgaggcaaaatctccatatgccatgtactcagagacagtggagcttataaggtacgca
atgaggctgaagagccactctggccctggggcaagacaggaagacaaacagctggcggtt
ctgtgtttccgatgccttgccctactttactggcagatgtttcgcttaaagaaggaccat
gcactgaaatactccaaagtgctgctggactattttaagagttctcccaaagtgcctact
acaccaccctgttggaatgactctgggaagggtgcaggaggacccccgtcatcactctca
cccaatgccaaacaccttggacggggttcacatgggggcagcacctccccctctctcata
agcattccccaacgtatccaccagatggcagcaaatcatcttaacataactaacagtgtc
ttgtacagctatgagtactgggaggtggctgacaaccttgcaaaggagaataaagagttc
ttcaattacttgaatactttgtctgggccactgactcttcacagcagcatcgctcacaca
gtccaatacaccagacaggctcttcagtggatacgcattagtgccaaacttaactaa

DBGET integrated database retrieval system