KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655097
Entry
111655097         CDS       T06058                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:slal04040]
    111655097 (asic1)
Ion channels [BR:slal04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   111655097 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 111655097
NCBI-ProteinID: XP_023262116
Position
Unknown
AA seq 560 aa
MPVRIMCTISFSADDEPSRGYGKDGFDDHYKRVKKSYGDGDSQDYLDGCSQVDDYNDEEE
NVSEVDDLAAFFSGCSLHGANHVFVENKRFGIRQGLWAVVFTMALSAFLFQVADRVIYYL
QYDYITMLDERVANNMTFPAVTICNYNFIRKSQMSYSDLIFMGPLLGFEEGMAPGFPLAP
EPDRPPGSRFSLDEFYNRTRHRIEDILLECDFRGLECGPENFREIFTRYGKCYTFNSGQD
GRPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCKATPMDSDFFSTYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNLTRYGKEMSFVKIPSK
ASAKYLAKKFNKTEQYIADNILVLDIYFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTILELFDYLYEVIKYKLCRCVKKKHKGRNNNDRGAVLSLDDVKRHAPCENLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgcctgtccgaatcatgtgcaccatctccttttctgccgatgacgagcccagcagagga
tatggcaaagatggttttgatgaccactacaagcgcgtgaagaagagttacggcgacggg
gactcacaggactacctggatgggtgtagtcaggtggatgattacaatgatgaggaagaa
aacgtcagcgaggtggacgaccttgcagctttctttagcggttgctcactgcacggcgca
aaccatgtgttcgtggagaacaagaggtttggtattcgtcagggtttgtgggcggtggtc
ttcaccatggccctgtccgctttcttgttccaggtagctgacagggtcatatactatctc
cagtacgattacatcaccatgctggatgaaagagtggccaacaacatgacctttccagct
gtcaccatatgtaactacaacttcattcggaaatctcagatgagctacagcgacttgatt
ttcatgggccccctgctgggcttcgaagaaggcatggcaccagggtttccgctcgccccg
gagccggaccgcccgccgggctctcgtttcagcctggatgagttctacaaccgcactaga
caccgcatagaggacattctgctggagtgtgacttcagaggcttagagtgtggccccgag
aacttcagagaaatattcacacgctatggaaaatgctacacctttaattcaggccaagat
ggacgacccctgttggtgacgatgaagggtgggatgggcaatggcctggagctgatgttg
gacattcagcaggacgaatacttgcctgtatggggagagactgacgagacatcgtttgaa
gcagggatcaaagttcagatccacacccaggacgagccgccgttcatagaccagctgggc
ttcggtgtggcgcccgggtttcagacctttgtatcctgtcaggaacaacggctgacatac
ctgcctccgccgtggggggactgcaaggccacgccgatggactctgatttcttcagcact
tacagcatcacagcctgccggatcgactgtgagacacgatacctggtggagaattgcaac
tgcaggatggtgcacatgcccggagatgccccatattgcaccccagagcagtacaaagag
tgcgcagatcctgccttggacttccttgtcgagagggataatgactactgcgtgtgcgag
acgccgtgcaacctgacacgctacggcaaagagatgtcctttgtcaagatacccagcaaa
gcatcagccaagtatcttgcaaagaaattcaataagacagagcagtacatagctgataac
attctggttctggatatctactttgaagcgctgaactacgagaccattgaacaaaagaaa
gcctatgaattggcaggccttctgggtgatattggaggtcagatgggccttttcattgga
gccagcatcctcaccattctcgaactctttgactatctatatgaggtgatcaagtacaag
ctgtgccgatgcgtgaagaagaaacacaaaggccgcaacaacaatgaccggggagctgtg
ctgagcctggatgatgtgaaacgccatgctccttgcgagaacctgcgtacaccatcaaca
tatcctggcaacatgctacctcatcacccgggccagggtaactttgaagacttcacttgc
tga

DBGET integrated database retrieval system