KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655181Help
Entry
111655181         CDS       T06058                                 

Definition
(RefSeq) glutathione hydrolase 1 proenzyme-like
  KO
K18592  gamma-glutamyltranspeptidase / glutathione hydrolase / leukotriene-C4 hydrolase [EC:2.3.2.2 3.4.19.13 3.4.19.14]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00430  Taurine and hypotaurine metabolism
slal00480  Glutathione metabolism
slal00590  Arachidonic acid metabolism
slal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111655181
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    111655181
   00480 Glutathione metabolism
    111655181
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slal01002]
    111655181
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:slal04090]
    111655181
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.2  gamma-glutamyltransferase
     111655181
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.13  glutathione gamma-glutamate hydrolase
     111655181
    3.4.19.14  leukotriene-C4 hydrolase
     111655181
Peptidases and inhibitors [BR:slal01002]
 Threonine peptidases
  Family T3: gamma-glutamyltransferase family
   111655181
CD molecules [BR:slal04090]
 Proteins
  111655181
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G_glu_transpept
Motif
Other DBs
NCBI-GeneID: 111655181
NCBI-ProteinID: XP_023262240
Position
Unknown
AA seq 572 aa AA seqDB search
MVKKTIIVALAILLLASVATFVGVFFGVGRRKHPSEQVYLKAAVAADAGPCSEVGRDILM
KGGSAVDATIAALLCVGLMNAHSMGIGGGLFFTIYNATTGKVETIDARETAPRNATENMF
GNSTDLSQKGGLSVAVPGEIRGYEMAHRRHGKLPWKDLFQPSIHLAEKGFPLGRALATAV
SRQKKTIIKDKALCEVFCGKNGDVLKENETITFTKLAETYKKIAEEGPDAFYDGPLAQNL
VTDIQAAGGIITMEDLKDYKPLLDENPLRVTVGEYIMAVPNAPASGPVLSLILNILNGYN
FTSDSMASTEKKILTYHRIVEAFRFAYAKRTLLGDPRFLNITDLIHNMTSSFYADELRGK
ITDETTHHMNYYEPEFYLPENHGTAHISVVAEDGSAVAATSTINQYLGSKVMSRSTGIIL
NNEMDDFSSPLITNGFGVPPSPNNFIRPGKRPMSSMCPTILFDKENKVKMVVGGSGGTKI
TTSIAQVILNALFFNYDLTKAVSDPRLHNQLSPNTTVAEPDFDKNILDGLALKNHETELL
KSTGAVVQAVVRHDDGLHAQSDPRKWAYAAGY
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggtcaagaagacaataattgtggcactggcgatactgctgttggcgtcagttgccact
tttgtgggtgttttcttcggtgtggggaggaggaagcacccaagtgaacaagtgtacttg
aaggcagctgtggcagcagatgctgggccgtgttcagaggtcggcagagacatactgatg
aaaggcggatctgcagtggatgccactatagctgcattactgtgtgttggcctcatgaac
gctcacagcatgggcattggaggaggacttttcttcaccatctacaacgcaacaactggt
aaagttgagaccattgatgccagggaaactgctccacgcaatgcaacagagaacatgttt
gggaacagcacagatttatcccagaaaggaggtttgtctgttgctgtaccgggggagatt
cgaggttacgagatggcacacaggcgacatggtaaactgccttggaaagatttgttccag
ccaagcattcatcttgcggaaaaaggttttcctttgggcagggcacttgccactgctgtg
tccaggcagaagaaaaccatcatcaaggacaaagctctatgtgaagtgttttgtgggaaa
aatggtgacgtcctaaaagaaaatgagaccattacatttaccaagcttgcagaaacctat
aagaaaatagctgaagagggtccggatgctttctatgacggaccactggctcagaacctt
gtgacagatattcaggcagcaggcggtatcatcacaatggaggatctgaaggattataag
cctctcttggatgagaatcctttaagggtgactgtgggggagtacatcatggctgttccc
aatgcccccgctagcggccctgtgctctcactgatattaaacatcttgaatgggtacaac
ttcacctcagatagtatggcaagcacagagaaaaagatcctaacctaccatcgcatcgtg
gaggcctttcgttttgcttatgcaaagaggaccttacttggagatccgaggtttctcaac
atcacagatctcatccacaatatgacttcgagtttctatgccgatgagctccgtggaaag
attacagatgaaaccacacatcacatgaactactatgagcctgagttttacctgcctgaa
aaccacgggaccgcacatatctctgtagtagcagaggacggaagcgctgtggcagccacc
agcaccatcaaccaatatttgggctccaaagtcatgtcaagatcaactgggataattctc
aacaatgagatggacgacttcagctccccgctcatcacaaacggctttggagtgcctcct
tcaccgaacaacttcatcaggccagggaagaggccgatgtcatctatgtgtccaaccatc
ctctttgataaagagaacaaagttaagatggtggtcggaggctcaggagggacgaaaatc
actacttctatcgctcaggtgatcctgaatgcactcttcttcaactatgatctgactaaa
gccgtgtcagatccaaggctccacaaccagctgagtcccaacaccaccgtagccgagcct
gactttgacaaaaacatcctggacggtttggcgttaaagaaccacgagacggagttgctc
aaatcaacaggagccgtggtgcaggcggtggttcgtcatgatgacggactccacgctcag
tcagatcctcgcaagtgggcgtacgctgcagggtactga

DBGET integrated database retrieval system