KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655348Help
Entry
111655348         CDS       T06058                                 

Definition
(RefSeq) titin-like
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
SSDB OrthologParalogGFIT
Motif
Pfam: fn3 I-set Ig_3 Pur_ac_phosph_N ig Ig_2 fn3_2 fn3_4 V-set SusE RL11D
Motif
Other DBs
NCBI-GeneID: 111655348
NCBI-ProteinID: XP_023262464
Position
Unknown
AA seq 2145 aa AA seqDB search
MEASNNATGEKAEDKAHTLNINMKPDTDAQLTAEDSQSPSTLIVQGSSDTSAENREHNPR
VPPGSATDKENAIKPTLQITFSTFSVKNGENLKVEIPVVGHPMPKIEWKRDGQLVKETSR
LEISTTPSLTVLHIRHAAREHSGQYSVTASNTAGKFTGEITLVVLEKPDPPTGPVRIDEV
NSDYVTISWEPPEYTGGCQLDNYIVEKRETTSTEWQTVSATTVRTTIKVTKLKTGSEYQL
RVFAENRYGKSTAITSPIVIAQYPFSVPASPGTPFVSTVTKYSMVVEWEPPTKDGGSPII
GYHLERKEKNSILWTKLNKLVIPNTRFKTSGLQEGIDYEFRVFAENIAGLSSSSQISECY
VARDPCDPPGKPEAVVITRENITLEWAKPKYDGGSTITGYVVEKKELPDGRWMKANFTNV
IENQFAVTGLTGGQSYEFRVTAKNGAGVWSTPSESVTIIAQDVIEGPTAFIDPKFKSATG
VQAGETFVIEADYFGKPLPDVIWLKDGKEIDKTTPRMEVKNTLTHTTLTLRDCTRVDGGH
FVLILSNVGGTTSVPVNVRVLDRPGPPDGPLKVKVVSAEKCNLHWNPPVNDGGACVSHYI
IEKRETSRVTWTGVDAHVEAVSYKVTKLVPGKEYIFRVAAVNKFGVGEFLESEPFIAQNP
FTTPSAPSTPTASAVTGDSIALTWERPESDGGTEIDGYILEKRDKEGVRWTKCNKRRLND
LRFRCTGLTEGHYYQFRVLAENAAGVGAPSEPSEYIKVCEATYPPGPPTNPKVTDFTSSS
VSLTWSKPIYDGGAVISGFMVEMKETLEDEWVVCTPSTGIKETNYTVKRLKENAEYNFRI
RAMNPAGVGEHVELPGSVKAAEKLEGPEIELDTALRKIVNVRACSTLRLFVTIKGRPEPE
VKWSKEGGPLSERAQIEVTSSYTVLLIENVNRNDTGKYVLTAENCSGTKSAFINVRVLDS
PGKPTNLEVKEVKRDSVSISWETPLIDGGTKISHYIVEKREEARKAFTSVCSSCVRNSYK
IENLQEGCFYYFRVLAVNEFGAGLPAETAEAVKVSEAPLPPGKITLIDVTCNSAGLSWEK
PDHDGGSKITCYIVEMQAEGDDTWTICSESKALEVTVTGLTKGKEYFFRVSAVNEKGRSE
PKSLLTPVIVKDTSAEPIICLLSNTFSVKAGNDLKIEVPFKGVPPPTVAWKKDGNMLKET
SRVNVQTSDTSSQIIIKDATRVDVGVYEVTLTNSVGNTSAEIFVNVFERPGPPSDLSVDE
VSADFVSLSWQPPHYTGGSQISNYVVKKRDTGSTAWQTVSATVARTSIKISRLTQGTEYQ
FCIAAENRYGKSQFVEFEPVVAQYPFKPPGPPTNLHVVQASKSVMVIAWSKPDSDGGSPI
IGYHIECKDQSSILWTKLNRSPVTENQFKVTNVEEGLIYEFRVCAENMAGVGPCSKASDP
VAARDQCDPPCNLTVTNITNSSVSLSWNKPEYDGGAKITGYIVERKELPDSCWLKCNFTN
LLDTSLEVTGLTEGEQYDFRVIAKNSAELFSAPSETTGPVTVQHDVEPPKIILEDKFRQV
LIVKAGDLLKMEADISGRPNPTVFWLKNSRNIGTKGRIEITATKTHTSLLIRESVRKDSG
QYTLTLQNTGGTTSKVITCKVLDRPGPPAGPLEVSGLSAEKCTLSWGPPHETGGADIMHY
IVEKCETSRVSWTLVYDNMMATTCKITKLLKGNEYLFRVRAVNKYGEGETLDSEPIRAMD
PFTIASAPMDVEVTSASSDAMTICWKRPASDGGSRISGYVIEKREKQGVRWVRVNKKPVY
DLRVKASGLHEGCEYEFRVFAENAAGLSEPSLPCPLTLAEDPKFLPSPPAKPIIADSTRS
SITLSWNKPLFDGGAAVTGYKVEFRKSTEDDWAVGVHNTDKTEFTVSGLASGAEYVFIVR
SINKIGISEPSPETDPQVAIEREEEPKFDISPEMRKTLLVKDGSSFTLTMPFTGKPVPTV
SWDKADVDLRVRGLINTTSSVTSITVERASRDDSGKYKVKLQNVAGSASLTLNVRVLDSP
GPPAHIAVKDVTKNSATVTWDIPENEGGAPVKNYLVDIRDLSRKGWTRLTDKCRRLSYRV
SDLEEGGIYFFRVTGENEYGIGVPTETKEGTKMTDTTDWDTNPGA
NT seq 6438 nt NT seq  +upstreamnt  +downstreamnt
atggaagcaagcaacaatgcaacgggagagaaagcagaagataaagctcacactctaaat
ataaatatgaaaccagacactgatgctcagctcacagcagaggattctcaatcaccctcc
acactcattgtccaaggttcatctgacacttctgcggagaacagagaacacaacccaagg
gtgccacctggctctgccacagataaggaaaatgctattaagccaacgctccagataact
ttcagcacattcagtgtcaagaatggtgaaaatctgaaagtagagatcccggtggttggg
cacccaatgccaaagattgaatggaaaagagatggtcagttagttaaagagacatcaaga
ctagagatttcaactacaccttcactaacagttcttcatatcagacatgctgcgagggag
cactctggtcaatactcagtcacggcaagcaacactgctgggaaatttacaggagaaatc
actttggttgttcttgaaaaacctgacccacccacaggacctgtgaggattgatgaagtc
aattctgactatgttaccatctcctgggagccacctgaatacacaggaggctgtcagcta
gacaactacatagtggagaaacgtgaaactacaagtacagagtggcagacagtgtcagca
acgacagtaagaactacaatcaaagtcaccaagctgaagacaggaagtgaataccagttg
agagtgtttgcagaaaataggtacggaaagagtactgcaatcacctctcctattgtaatt
gcacaatatccatttagtgtgcccgcttcccctggaaccccctttgtgtccacagtaaca
aagtacagcatggttgttgaatgggagcctccaaccaaagatggaggcagccccatcatc
ggttaccatctagaacgcaaagagaagaacagcattttatggaccaagctgaacaagctt
gttatacctaatactcgcttcaaaacaagtggactgcaggaaggcattgactatgaattc
agagtctttgctgagaatattgctggactcagctcatccagccaaatatctgagtgttat
gtggcaagagacccctgcgatccgcctggcaaacctgaagctgttgtcatcacaagagag
aacatcacacttgagtgggcaaaacccaagtatgatggtggaagcaccattacaggctat
gttgttgagaagaaggagctcccagatggcagatggatgaaggcaaacttcaccaatgtt
attgagaatcagttcgcagtcacaggtctgacaggaggccaaagttatgagtttagagta
actgccaagaatggtgctggtgtctggagcacaccttcagaaagtgtaaccatcatcgct
caggatgttatcgagggacccacagcgttcattgatcctaagttcaagagcgctactggt
gttcaggctggcgagacatttgttattgaagctgattacttcgggaagccccttcctgat
gtaatatggctgaaggacggaaaagaaattgacaaaactacaccaagaatggaggtcaaa
aacaccctcactcacacaactctgactctcagggactgtacccgagtggatgggggccac
tttgtactgatccttagtaacgtcggcggaactacatctgtgccagttaatgtgagggtc
ctggatagacctggtcctcctgatgggcctctgaaggtgaaagttgtcagtgcagagaag
tgtaatcttcactggaatcccccggtaaatgatggcggtgcctgtgtttcccactacatc
attgaaaaaagggagaccagccgtgttacatggactggggttgatgcccatgttgaagct
gtcagttacaaagtgacaaaactggtgcctggaaaagaatatatattcagagttgctgca
gtgaataaatttggtgttggtgaatttttggaatcagagcccttcattgcacagaaccct
tttacaacacctagtgcgccttctacccctacggccagcgctgtgactggtgactctata
gcactaacatgggaaaggccagagagtgatggaggcacagagatcgatggctacatcctg
gagaaacgtgacaaagaaggtgtcaggtggactaaatgcaacaagagaagactaaacgat
ttgcgtttccgatgcacagggctcactgagggacattactatcagtttagagtattggca
gaaaacgctgctggtgtgggtgcaccaagtgagccaagtgagtatataaaagtctgtgaa
gctacttacccacctggtccccctaccaaccctaaagtgacagattttaccagtagttct
gtgtctctgacctggtcaaagcctatctatgacggtggagcagtcattagtggatttatg
gttgagatgaaagaaacattagaggatgagtgggttgtatgcacaccaagcacaggtata
aaggaaacaaactacaccgtgaagagactgaaagaaaatgcagagtacaattttcgcatt
cgtgcgatgaaccccgccggagttggagagcatgtggaactacctgggtctgtgaaagca
gcggaaaaattggagggacctgagattgagttggacactgccttgaggaagattgtgaat
gttcgagcctgttccacattacgtctgtttgtcaccatcaagggaaggccagagcctgag
gttaaatggtcaaaggaaggtggacctctcagtgagcgggctcaaattgaggtaacaagc
tcctacacagtgttactgattgagaacgttaatagaaatgatacaggaaagtatgtgttg
actgctgagaactgcagtggcactaaatcagcattcatcaacgtcagagtactggactct
cccggcaaaccaacaaacctagaggtgaaggaggtaaagagagactctgtgtccatctcc
tgggagacaccgctcattgatggaggaacaaagatttcgcactacatcgtagagaagcga
gaggaggctagaaaggccttcacaagtgtctgcagcagctgtgtgagaaactcatacaag
attgaaaatctccaggaaggatgcttttattatttccgtgtcctggctgtgaatgagttt
ggggctggactgccagcagagaccgctgaggctgttaaagtttctgaggctcctctgcct
cctggcaaaatcacactcattgatgtcacttgcaatagtgcaggactctcttgggagaag
cctgaccatgatggaggaagcaaaatcacatgttatatagtagaaatgcaagctgaggga
gatgacacatggacaatatgttcagagagtaaagcactggaagtgactgttactgggctg
acaaaaggaaaggagtatttctttagagtgagcgctgtgaatgaaaagggaaggagtgaa
ccaaagtccctgttgacacctgttatcgtaaaagatactagtgctgagcccattatttgt
ttgctctccaacacattcagtgtgaaggcagggaacgatttaaagattgaggttccattc
aaaggtgtgccgccaccaacagtagcctggaaaaaagatggcaacatgctgaaagagaca
agcagggtaaatgtgcaaacatctgacacgtcatctcagatcataatcaaagatgccacc
agggtagacgtcggtgtctatgaggtgactctgaccaattctgttggaaacacatctgct
gaaatttttgtcaatgtctttgaacgacctggaccaccaagtgacctcagtgtggatgaa
gtgagcgctgactttgtgtctttgtcatggcagcctccgcattatactggcggatctcaa
atcagtaattacgttgttaagaagagagatacagggagcacagcctggcagactgtgtcg
gctacagttgcaagaacatcaatcaaaatttcccgtctgacacaaggtactgaatatcag
ttttgtattgctgcagagaatcgctatggcaagagccaatttgttgaatttgaacctgtt
gtcgcccagtatcccttcaagccccctggtccaccgaccaacctccatgttgtacaagcc
tcaaagtctgttatggtcattgcttggagcaaaccagacagtgatggtggcagccctatc
attggataccatattgaatgcaaagatcaaagcagtattctgtggacaaagttaaacaga
agcccagtgactgagaaccagttcaaggtaacaaatgttgaagagggcctgatatatgag
ttccgtgtctgtgctgagaatatggcaggggttggaccctgcagcaaggcatctgatcct
gtagcagcaagagaccagtgcgatcccccatgcaacctcacagtcaccaatataactaac
agctcagtttccctgtcatggaataaaccagaatatgacggtggagctaaaataaccggt
tacattgttgagcgtaaagagctgccagatagttgctggcttaagtgcaactttaccaac
ttactggacacctccctggaagtgactggcctcacagagggtgaacagtatgattttcgt
gtgattgcaaagaattcagctgagctcttcagtgcaccttctgaaaccacaggacctgtg
actgtacagcacgatgtagagccacccaaaattatcttggaggacaaatttagacaggtg
ctgattgtcaaagcaggagacctcctaaaaatggaagctgacatctccggtcgccccaat
cctacagttttttggttgaagaatagtagaaatattggcaccaaaggaaggattgagata
actgcaacaaagacacatacctctctacttatcagagaaagtgttaggaaagactctgga
cagtatactctgaccctgcagaatacaggtggtaccacatctaaggttatcacttgcaag
gtcctggataggcccggcccacctgccggacctctggaagtgtctggactctcagcagag
aaatgcaccctgtcgtggggaccccctcatgagactggcggtgctgacatcatgcactac
attgttgagaagtgtgaaaccagccgtgtctcctggactcttgtgtatgataacatgatg
gcaactacttgtaagataaccaagctgctcaaaggaaatgagtacctgtttagagtgagg
gcagtgaacaaatatggggagggtgagactttggacagtgagcccatcagggcaatggat
ccctttactatcgcatctgctccgatggatgttgaggtcacaagtgcaagcagcgacgca
atgactatctgctggaagagacctgcctctgatggtggtagccgcatcagtggttacgtc
attgagaagagggagaagcagggtgttcgctgggtaagagtcaataaaaaaccagtctat
gacttacgagtcaaagcctctggtctgcatgagggatgtgagtatgaattcagagtcttt
gctgagaatgctgcagggttaagtgaacccagtctcccatgcccgctcaccctggcagag
gatccaaagtttctaccatcccctccagcaaagccaattatagctgattcaaccagatcc
tcaatcactctgtcgtggaacaagccgctgtttgatggtggagcagcagtaacagggtat
aaagttgaattcagaaaatcaacagaagacgactgggctgttggcgttcataacacagat
aaaacagagtttacggtaagtggactcgcatcaggggcagaatatgtttttattgtcaga
tccataaataagattggcatcagcgagcccagtcctgaaacagatccgcaggtagccatt
gagagagaggaggagcccaagtttgatattagccctgagatgaggaagactctacttgtt
aaggatggcagctccttcactttgactatgcctttcaccggcaaacctgttcccactgtg
tcatgggacaaggcagatgtcgatctgagagtcagaggactcatcaataccaccagctcc
gtcacctctatcacagtggaacgggcatcacgtgacgactctggcaaatacaaagtcaaa
ctgcaaaatgtcgctggatctgcctctttaaccctgaatgtgagggttttggattcccct
ggtccaccagctcatatagcagttaaagatgtgaccaagaactctgccactgttacctgg
gacatccctgagaatgagggaggagctcctgtcaagaactaccttgtggacatacgggac
ctcagcaggaaagggtggacaagactcacagacaaatgccgccgactgtcctatagggtg
tctgacctggaggagggaggaatctacttcttcagagtcactggggaaaatgagtatggg
attggtgttccaactgagaccaaggagggaacgaaaatgacagatacaacagactgggac
acaaatccaggagcttag

DBGET integrated database retrieval system