KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655407Help
Entry
111655407         CDS       T06058                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111655407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:slal03041]
    111655407
Enzymes [BR:slal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111655407
Spliceosome [BR:slal03041]
 Complex C
  Other components
   Step II factors
    111655407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 DEAD AAA_22 Flavi_DEAD T2SSE ABC_tran AAA_30 AAA_19 DUF2075 Sigma54_activ_2 AAA_7 AAA_16
Motif
Other DBs
NCBI-GeneID: 111655407
NCBI-ProteinID: XP_023262570
Position
Unknown
AA seq 1192 aa AA seqDB search
MAALDEIKRLEYLSLVSKVCTELENHLGISEKDLAEFIINLAEKHPTIEEFKAVLLQNGA
EFTDTLIGNLLRLIHTMRSSPSTSKALQPEANPKSEKDKLKVKYPALCKPDDPVWIIPPP
HTDKDDEQIALAAMKELEMLMPSVCGASSDNRSDRNSQCDRGRDADRESGCKRSRSRSKS
RDRDGETNHKRRRKRVSRWSDRPPSPNRGNNDNNNKEEDGDRWRESDRPVDRPPPDEPVV
GDIYNGKISSIMQFGCFVQLEGLRKRWEGLVHISELRKEGRIANVADVVTKGQKVKVKVL
SFTGTKASLSMKDVDQETGEDMNPNRRRNPGVEVVDENMRNPDRPNEVSMLEMEENPTEH
KRLTKITDLEKWEINQMIAANVLPKEEFPEFDEETGILPKIDDDEDEDIEIDLVDDEPPF
LRGQTKWTLNMSPVKIVKNPDGSLSQAAMMQSALAKERRELKQAARAAEMDCIPTGLNKN
WIDPMPDYEGRQIAANMRGIGAMPIDLPEWKRYALGGNQVSYGKKTELSILQQRESLPIF
KLKEQLTQAVHDNQILIVVGETGSGKTTQITQYLAEAGYTSRGKIGCTQPRRVAAMSVAK
RVSEEYGCRLGQEVGYTIRFEDCTSTETVIKYMTHGMLQRECLVDPDMSQYSLIMLDEAH
ERTIHTDVLFGLLKKTIQKRKDMKLIVSSATLDAVKFSQYFFEAPIFTIPGRTFPVEILY
TKEPETDYLDAGLITVMQIHLTEPPGDVLVFLTGQEEIDTACEILYERMKSLGPDVPELI
ILPVYSALPSEMQTRIFDPAPPGSRKVIIATNIAETSLTIDGIYYVVDPGFVKQIVYNSK
TGIDQLVVTPISQAQAKQRSGRAGRTGPGKCYRLYTERAYRDEMLTTNVPEIQRTNLAST
VLSLKAMGINDLLAFDFMDAPPMETLIIAMEQLYTLGALDDEGLLTRLGRRMAEFPLEPM
LCKMLIMSVHLGCSEEMLTIVSMLSVQNIFYRPKDKQAQADQRKTKFFQPEGDHLTLLAV
YNSWKNNKFSNPWCFENFIQARSLKRAQDIRKQMLSIMDRHKLDVVSCGKSTMRVQKAIC
SGYFRNAARKHPQDGYRTLIDQQVVYLHPSSTLFNRQPEWLVYHELVLTTKEYMREVTTI
DPRWLVEFAPAFFRVGDPTRLSRQKRMQKLEPLYSRYEEPNAWRISRAFRRR
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggctgctttagacgaaataaaacgtctcgaatatctatctttggtgtcaaaggtgtgc
acagagctggagaatcatctgggaataagcgaaaaagatttggctgaatttatcatcaac
ctcgccgaaaaacacccaacaattgaggaatttaaagctgtgctattacaaaatggagca
gaatttacagatacccttattggtaatttactcagacttattcatactatgcgctcctca
ccatctacaagtaaagcacttcagccagaggcgaacccaaagagtgagaaggacaagctg
aaagtgaaataccctgctttgtgtaaaccagatgaccctgtgtggatcattcccccgcca
cacacagataaagacgatgagcagattgcattagcagccatgaaggagctggagatgctt
atgccaagtgtttgtggggcaagctctgataacaggtcagacagaaattcacaatgtgac
agaggtcgagatgcagacagagaaagcggatgtaagcgaagtcgctctcgctccaaatca
agagatcgcgatggagaaacaaaccacaagcggagaaggaaacgagtgtctcgctggagt
gaccgtccaccaagcccgaacagaggtaacaacgacaacaacaacaaggaggaggatggg
gaccgctggcgtgagagtgatagacctgtggatcggcctccgccagacgagcctgttgtg
ggtgacatctacaatggcaaaatcagcagcattatgcagtttggttgctttgtgcagctc
gagggcctcagaaaacgctgggagggtctggtgcatatctcagagttgcgcaaagaagga
cgtatagcgaatgtggctgatgtggtcaccaaaggccaaaaggtgaaggtcaaagtgctg
tcattcactggaaccaaagccagcctcagtatgaaggatgtagaccaggagacaggggag
gacatgaaccccaaccgaagaagaaacccaggtgttgaagttgtagatgaaaacatgagg
aaccctgaccgccccaacgaagtcagcatgctggaaatggaggaaaacccaacagaacac
aaacggctcacaaagataactgaccttgagaagtgggaaattaatcagatgattgcagcc
aatgttcttcctaaagaagagttcccagaatttgacgaggagacgggaattcttcccaaa
atagatgatgatgaagatgaagacatagagattgatctggttgatgatgaaccaccattc
ctgaggggacagactaaatggaccttgaatatgagcccagttaaaatagtgaagaatcca
gacggctccctttcccaggcggccatgatgcagagcgcactggctaaggagaggcgggag
ctgaagcaggcggctcgcgcagcagagatggactgcatccctactggtctcaacaagaac
tggatagacccaatgcctgattatgaaggaaggcagatcgctgccaacatgagaggcatc
ggcgctatgcctatcgatcttccagagtggaagagatacgccttaggagggaaccaggta
tcgtatggcaagaagacagagctctccatcctgcagcagagagagagtctgcctattttc
aagcttaaggaacagctcactcaggctgttcatgataatcagatcttgattgtagtcgga
gaaaccgggtcaggtaagaccacacagatcactcagtacctggcagaggcaggctacacc
tcccggggaaagattggctgtacgcagccccgtcgtgtggctgccatgtcagtggccaag
agagtctctgaggagtatggatgtcgtctaggccaagaggtgggttacaccattcgtttt
gaggactgcaccagtacggagacagtaatcaagtacatgacccatggtatgctgcagaga
gagtgtctggtggacccggacatgagccagtattccctcattatgctagatgaggcccac
gagagaacaatccacactgacgtgctgttcggcctcctcaagaagacgatacagaagcgc
aaagacatgaagctgatcgtgtcctctgctacactggatgctgtcaaattctcccagtat
ttctttgaagctcccatattcaccatcccgggaagaaccttcccagtggagatcctctat
accaaagagcctgagacggactacctggatgccggtctcatcactgtcatgcagatccat
ttaacagagcccccaggtgacgtcctggtgtttctgactggacaggaagagatcgacacg
gcctgtgagatcctgtatgagcgaatgaagtcactggggcctgatgttcctgagctgatt
attctgccagtttattctgccctgcccagtgagatgcagaccaggatctttgatccagcg
cctccaggcagcagaaaggtcatcattgccacaaacattgctgagacgtctctgactatt
gatggaatctactacgtggtggatcctggttttgttaagcagatcgtgtataattccaag
accggcattgaccagcttgtggtgactcccatatcacaggcccaggccaagcagaggtca
ggtcgagccggcagaacaggcccggggaagtgttacaggctctacactgagagagcctac
agagatgagatgctgacgaccaatgtgcctgagatccagagaaccaacttggccagcact
gtgctgtctctgaaggccatgggtattaatgaccttctggcgttcgacttcatggatgct
cctcccatggagactctgatcatagccatggagcagctgtacactctgggagctctggat
gatgaaggattactcacacggctgggtagaaggatggctgagttccctctggagcccatg
ctgtgtaagatgttgatcatgtccgtccatctgggctgcagcgaggagatgctcaccatc
gtctccatgttgtctgttcagaacatcttttatagaccaaaggacaaacaggcccaggct
gaccagaggaagacaaagtttttccagccggagggagaccaccttacactgttggctgtc
tacaactcctggaagaacaacaagttctccaacccctggtgttttgagaacttcattcag
gctcgctcattaaagagagctcaggacatccgcaagcagatgctgagcatcatggacaga
cacaagctggacgtggtgtcttgtgggaaaagtacgatgcgggtccagaaagctatttgc
agcggttacttcaggaacgcagccaggaagcaccctcaggacgggtaccgtaccctgatt
gaccagcaggtggtgtacctccacccctccagcactctgttcaaccgccagccggagtgg
cttgtgtaccatgagctggtgttgaccaccaaggagtacatgcgggaggtgactaccatc
gaccctcgctggctggtggagttcgccccggctttcttcagagttggtgaccccacgcgc
ctcagccggcagaagaggatgcagaaactggagcctctctacagccgctacgaggagccc
aacgcatggaggatctcccgcgcctttagacgacgctga

DBGET integrated database retrieval system