KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111655510Help
Entry
111655510         CDS       T06058                                 

Definition
(RefSeq) titin-like
  KO
K12567  titin [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111655510
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:slal04131]
    111655510
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:slal04812]
    111655510
   04147 Exosome [BR:slal04147]
    111655510
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111655510
Protein kinases [BR:slal01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   111655510
Membrane trafficking [BR:slal04131]
 Others
  Actin-binding proteins
   Others
    111655510
Cytoskeleton proteins [BR:slal04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     111655510
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   111655510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set fn3 Ig_3 ig Ig_2 V-set Pur_ac_phosph_N C2-set_2 fn3_2 Tissue_fac fn3_4 Ig_6 Izumo-Ig Ig_C17orf99 Ig_5 Ig_4 THB Titin_Z
Motif
Other DBs
NCBI-GeneID: 111655510
NCBI-ProteinID: XP_023262716
Position
Unknown
AA seq 17464 aa AA seqDB search
MSTQAPTFTQPLQSVVALEGSAATFEAQVSGSPVPEVSWFRDGQVLSAAALPGVQISFSD
GRAVLRIPAVTAAHSGRFSVRATNGAGQATSTAELLVTAETAPPSFLQRLQSSTVRQGSQ
VRLDVRVTGIPAPVVKFYREGAEIQSSADFRILQDGDLYSLLIAEAFPEDSGTYSVTATN
SSGRATSTAELLVQGEEAVPAKKTKTVISTSQISQSRQTRVEKRMEASFQASAMMQMQVE
GAELTQQLAHKTPPRVPPKPTSKSPTQHSLVAKVTGGRQQSPSPVRHVKAPTPTPVRPAS
PTSRLSVSPIRPVKSPITTRKQVAVGADVLPPWKQGDYMAEASYTSMTSMTSMTSMTSST
VTQLGQEQHWEQQVTGVKEAGGGKRAGAVAKVVAAVDLARVRQPMHVEGGRAEEEEAVEA
ELRQQGIATAAAAASTAADEQYQAGWTTTRVQAGQMLTTAQAFAPEPTLALPQIQRATEI
SSHVDTGLAPSPVPHFTVSKVSVPKPESSSEVSIAGSAIATLQKELSSSSAAARKIIRPV
KSPSPCRVAETRVTPEPIPPPFKDFSEKYQSRLGTELQRGVVSSGGMERVYEDWAVQVVE
VAAVPSAGDGVVPPTLMSGLKNTNVTEGESVTLECQISGHPAPVIMWFREDYKIETSIDF
QISYESGFARLVIREAFAEDSGRFTCTATNEAGTVSTSCYLLVQVSEDIESREEITIVTE
HVETAQEKLVTEEAKEETISQVSVAESDAAAAAPFFIKKPTVQKLVEGGSVIFECQVGGS
PKPHIIWKKSGVPLTTGYRYKVAYKKETGECRLEISMTFADDAGEYSVFAKNQLGEVSAS
INLLEEEEYEAYMKKEEASFKTEVTAMVQEPKVGDVPPVVVTTTEQMTTTIISGQEFHLS
AIEQRIIQEIELRIMKITYREIVTEDGELMVTAAPTEAVQPAFDTPVKNYRIMEGMGVTF
HCKMAGMPLPKIAWYKDGQRIRAGDHYQMEVLQDGRASLRLPVVLPEDEGVYTAFATNLK
GNAVSSGKLYVEASGAAPPQRYTPQPAVQRIRSTSPRSLSRSPGRSSSRSPGRSPARRLD
ETDEAQLERLYKPVFVMKPSSYKCSEGQTARFDLKVVGRPMPDTYWFHNGQQVVSDYTHK
IVVKEDGTQSLIIVPAMPQDSGEWTVVAQNRAGRSSLSVTLTVDAKETLVRPQFTDKLRN
ISVKQGTLVELAVKAIGNPLPDIVWLKNSDIITPHKHPNIRIEGTRGEAKFQIPSAAGPD
SAWYTATAINKAGRDTTRCRVNVEVDYAEPEPERKLIIPKGTYKAKEITPPEVEPLHLRY
GQEQWEEGDLYDKEKQQKPLFKKKLTSVRMKRFGPAHFECRLTPIGDPTMVVEWLHDGKP
LAAANRLRMVNEFGYCSLDYEVAYARDSGVITCRASNKFGVDQTSATLIVKDEKGLVEES
QLPEGRKGAHRIDEIERMAHEGGPYGVTAEEETEKLKPEIVLLPEPVSVMEGDIARFRCR
VTGYPAPKVNWYLNGQLIRKSKRYRLRYDGIYYMEITEIKSYDSGEVKVMADNNLGSAEH
TVKLEIKEKEDFRTHLRRAPEAKAAEAAPELGKTPFEVVKAEKHAEDSHLKEVVKLKKAH
RIVHEKATEETEELRSKFKRRTEEGYYESITAVELKSRKRDESYEDLLKKTKEELLHRAK
EKEEAEKKKEEERLKLTAKPLKPERVKLSASMEAPKILERITSQTVAQGDEVKFRVRVIG
RPEPECQWFKNGVQLEKSDRIYWYWPEDHVCELVIRNVRAEDSASVMVKASNTAGETSSH
AFLLVQAKQVITFTQKLDDINAKEKDTMATFECETNEPFVKVKWLKNNEEIFSGDKYRMH
SDRKVHFLSVLMINMRDDAEYTCVVIDDDVRTTAKLNVEGAPLEILKQLESTEVPETYSG
EFECLVSREDAEGSWFFGEKLISPSSKYVMSSRRGRHTLSVKDVKKEDQGKYTFKVGEFK
TSASLKMKLRPVTLMQPLTDLTVCEGDIAQLEVKFSQENVEGTWMKNGQPVTASNRVHIV
IDRQIHKLLIEDTHKDDFGMYSFVVPAQEISTSGKLVIQTIGVLIPLKDTQAIEGTKVVL
ETKISAQDISSVKWYHNDQLVTPSDRIQMVAKGAKQRLVFNRTYASDEGHYKLVVGRADT
SCKFTVETVQIVTPMKDKECSESENVTFEVEVSHPGIDAFWTFKRQPLKAGSKHKMESKN
KRHILTVMNAMKDEEGEYMFAAGEKMCSASLTVTGGAIRKPLRDLVVADSQTAVLECEVA
NPSAEGKWLKDGQSVDFNENVVSEVKGAVRRLVIIITKATDIGEYTYQVATSKTSANLKV
EAVKVKKTLKNLNVVQTQEAVFSLELTHENVRGAQWIKNGVEIQPSDKYEIKTEGTAHTL
KIKNCTAQDESVYSFKLGKLSASARLNVETIKILKKPKDVTSLLGATASFEVGISEDDIP
VKWMFNNVELRPNEHYSILSEKKTHKLVVQNVDNSKEGVYTAVVGHLQCNARLTVESLRV
TKPMKSVEVPETQVATFECEVSHFNVPSTWLKDGVEIEMSEKFRIVVQGKLHQLKIMNTS
RDDSAEYTFICGNDKVSAKLTVNPILITTMLQNLNAQEKDTVTFEVNINYEGITYKWLKN
GVEIRSTDRCQARCKQLTHTLSIRNVHFGDSAEYTFMAGSAVTTAKLYVEARVVEFTKHL
RDLKITEKKRATFECEVSEPNVQVMWMKDGQELEISDRYKMTSDEFVHRLVLPSVRLSDA
GDYTAVAGSSMSKGHLAVEGRDIKISEPASRNITVVEKERATFEFEVDEEDVDGRWMRNG
VEIQFSVEERFNYATIRKLHRLTISETYRSDAGEYTFLAGRNRSTMNLHVRLPEPPQIVR
PMQPQTAMSGRSVRFSVQACGLPQPQVTWYKDSQALSTSYKCKFLHDGDEHTLLLLEVFP
EDATVYSCTAKNDYGEATSSASLNVEVPEVVEAAARVPPPVLIIPVHDILVAEGHRAQFQ
CNVSGEDLQVSWFCNDREIRESDIFRMSHYGDTCQLEISRVLHEHEGEFSCVAANSAGMV
TCAATLNIDVTAVEKESMIQEEVKVKPVFRHRIVPMEINIGNSAKFECETEDAPNVSFKW
YKDGQSIKEGDKYRIISRFRTSSLELLAPTKEDSGEYTCKASNQHGSDECSASLSVTEQY
PPAFVTKPDPQTVYVGKRAMIQCVITGSAPLNVVWLKDNQDLPKVPAQYQTFCEKNKHNL
EITTLEAADRGLYVCKVSNNVGTAECSMELRVIDKPNFVKPLGPVAAVVGAPLHLECQVD
EDTGVNVTWTRDGRKVHQSPDCKLSFEDKTVTLDIIKTTLKDCGNFVCTVANEAGSATCS
TSVKVQEPPVFVKRLEAATVWKQGSTSRLQCTIKGSPELHTTWFFNNSELSAGGRYSISL
KNGVATLEIQEVMLSDSGNYTCEVLNESGCESCSTKVTVKEPPSFKKEPLSIEAVRGSVA
VLACELSGSSPFEVSWKKNKKRLNTDKKYRIMSQGAVTSLEIHSFESADTGEYECVVSNE
VGSVTSKSVAKQKEPPMFSKRIESATAVLGNTVKLQGTLKGSAPITVKWMKDSELLRDDD
PNVKMKYENNITSISFSSVEIKHSGKYTCVAENEAGQQKCEAVLTVQEPARILEKAASIS
VTTGDSATLECTISGSPELKVKWFKDGKEMISGRKYKMMVKENTATLKILTAEKGDTAEY
KMEVSNKVGKDQSTCSVTVIGRAVPPSFTKALKKVDGRIGSNITLECRVSGSQPMVVSWY
KDNQEIHSDDKYKLDFSGSTASVLITGLDQSDGGVYTCQASNDAGEKETSGTLSIKEPPV
FTVKPESQDASPGSNVVMKSTFTGSAPLAVKWFREEKEVFTGGKCFIKKDSSSSSLELHS
VKPSDSAKYTCQVSNDAGRVDCTALLFVKEAPTFTMKLEPSQLLRTGQPLNLSCKVQGTP
VISIMWFKNGSEIISDHRHTMSFDSSIATLDVENCSVEDGGDYVCAASSEAGRDQCSSSV
TVKEPPVFVRSFESTEHVKGSDIILEGTVSGSAPFEISCFLNDKPIRNDSRHQISVENDT
VTVQISNCATGDAGMYQCTVANDVGETSCSCQISLKEPPSFVQRLEDMSCMVGSEISLKC
MLSGSLPMTFSWIKDDHELTEDEHVKMSHETKSAILNLKNAQLSHGGKYVCQAQNKAGTQ
RSAAVLIVTERKIPPNIIKKPSESMVDSVGKTVTMEARVSGSQPLNIMWYKDNNEISASN
KYDISFKNNIAVLCVGDSTTSDSGVYTCEVSNEAGRASCPVSLTISETGQAPKFDVRLEP
ASVNEGEKLSLKCHVSGSAPLSIQWMKDRRELKSSGNTKITFVGGMACLEISSVSKTDAG
DYLCKASNAIGSDFCKSRVTVRDKGTKVAPAEAPTPAAAAPVKRLDNLFFIEEPKNVSVT
EKGTATFIAKIGGDPIPSVKWMKGKWRQITPGGRISIEQKGQNAKLEIREVTKSDSGNYR
CVATNKHGEIECSADMEVTKKEEVEGIGDMRTRLKKTPSKQKSPKKDEEVDIVSLLRGHD
PKDYERILREHGIHDYRAILQAVEFLKREKEMETGKVEVEHGGRVEEEVMAQLIQQLEGR
VSTEPVSVLEDITDQMITENQSATFECQIRINYPEITLTWYKGTQKLDNSDKYDISSVGD
RHSLKIKNCQVKDQGNYRVVCGPHISNAKLTVTGVYSVIARLEPMGEARSTAELYLSGKE
IELGRVPQDVPDTSIQVPETESMVVYRDSTEVYHYEERTEVRAFESLTVEEETVSVRYSS
VTEEKKPVEEIVERTHVGQREEIPKVPEVYGRPEEKPSEPAAPPSAPVKVPEVKKPQPEA
PATAPPRREEPAAPKEPSVYTKPEPEPEIVPREVTPEPYQPKPKTAEPKMVPPEPKVTPH
KLAAPEPKVTPHKPAVPEPKVTPQKPAEPEPKVTPQKPAEPEPKAAKIKPEPEAPKVETV
KKAPEVPKPRVPAVAKPEEAIAQPPAAKITPSKTEDILVKVPEPSKPEEPVVQPTAAKVT
PSTPERLPTKVQDVPTPAEPVVQPSAPEVTPPKAEAVPTKVVSEPKTPEPPRKPHLLTGK
PEPDAPRYIPEPKPEEPKKVPEAQKKIPAAPKKVPEEPKKVVEETKKVPEAQKKVPEEPK
KVVEETKKVPEAPKKVPEEPKKVVAETKKVPEEPRKAPEAHKMVPEELTEPKKLAKVPKL
VTEEPVPHHKEPTPSPPQDLETPKQILQATKPQQQVKQREIPQETSVLAKPKLEAGTTKK
VPLKTDLKETVVVEDRKESVVIEENSLKMDIRQQIVLEKEEQVVSTWYSEDKHVEDAEPV
EDIEPAYIEYEDRKPEDTELFYGEDFALEEEAVDQREEISLRSVSPPLKKVAPLPSKRDI
TPPSQMIHPSKKEVSPPDTGITSKEEAYKKTLSESKQTIYTQQREVTESFVFVHREELEE
AAVFALEDRDKPKINVTPKIATVSKKSRPKDVTLLKPAEEVEEVPSDRSMSPPHRETVSP
PSEQDLPGILTTIPPKKEAMPPKKMKSPREEITKTSKAAVKINLEGNVPLQKPTAVPEVP
SPEELVQATRSLPVPAQVLSPGKAVCLEEEISPLGETESTKTSPALPKTVVEDFPSEEVT
LSKKPIHKDRVAPTKKSQVPPQKKLFPPEQETPPPKKPTSYTPKGITPHTDSSEEARTTA
TKLAPTRDDDKKAKKGTQEIDQQTLQKVSPPEEKKPSVPTPKPSPPPPPPSAPAQKVAPP
AVSPLEEKKPSAPVPKPVPARPAPAEKVAPAVSPPVEKKPSIPAPKPSAPAPTAAKVAPP
AVSPPEEKKPSPSTPKPPAEKVVPPAAPVAAVEKKPSPPAVKAEPSPVSEEISPPEDKGP
VSAPGPTKVLPLKQKGKIPVQEAKTPESPKLKSKFTRIPKEKEPEPEIIKLKRVPVKAPE
PEKQVLTRKAQVTKHHDPELTVHGLHDREDREIITLGRTERVFTAEEETVQLGLFEEAEK
VAVIQKTEKEGWTRSPKPQKEEDPEAPSVDKKKITKLPKADEQKELVKLKPFDKPGKPEE
EPQKIQLKKVPTKPKEPEKEVVTHKVDVTRHYDTELSVQKLRDREDREVITLGRTERVFT
AAEEASEMESMEEPEHLEAEDEKSRWIRTPKAPKDEEPEPDLTKKKIKKLPKKEEEPEVV
TLKPFEKPQKPEAAEPPKAKKEGEAKTDTERTPFKRHEIPQRDQPSAAIKHRKDEDIPST
SPEVIPDVSRDQTVIPQKKEIDQVPKDEEPTAADKLRGKPKTISTPDKEKEQVVLKPFTK
DAKPEEKSEKTSEEEKKKPVDTKITSRTPRDESPKDLKEQQLRGVEKTATPKKEDEKAQE
KEPAVPPKKPSPPGKKDMIQQEEGEKELPPKQTEAVKKGVELKKTPSPRVGKDKVEEEKA
LKPIKQLKKVELKKTPSPKAEPKPKEMEQVPIEKKPSAEKVKRIPKMVSPKDSIEAVTLK
KVPKKPSPQVVSEPEKPGKGRVPLVKEVSPGAVQMKKVPTQPEEEVFEEEGEEMEGEEDE
EAWGWELVPQEDWEDEGVDGALETPGMPGGKRDGKPSEEAPKGRGRGFGARQTPSPGDGG
RGRGLRPGGKGPSPPEDPFGGFKLKAVPLKFIKKLQDIVLKEAESIGSAAVFDCQVSPST
AITSWMKDGSNLREGPKHKFTSDGKDRKLNIIDVQLSDTGEYTCVAKNAGKEVTCTAKLI
VEELPVKWLKELEPETSCMKGQPMYLTCELNKERDVIWKRNGAILKKQAGKVAINVIGMQ
HAVTIQNSTDEDSGDYTCEVDGQEEVKTTTNVKVIEIIKDWLVKPLRDQHVKPKAKATFK
CELFKDTPNWKWFKGDNELTPSDKVEINKDGKDMTLTIKNCQPEDVAEYTIEVEDRRYSA
KLTLGEREAEILKPLASVEVVEKEEANFDTEISEDDVAGEWKLRGQVLTRSPTCDIKAEG
KKRFLTLKNVQLDQAGEVSYQALNANTSAMLTVKEGDPIFVVKLQDYTATEKDEVTLDCE
LSKDVPVVWYHEETEIIASKMVVMRCEGTRRSLVLKKVEQSDKGKYVCDCGTDKTSANIN
IEARDIKVVRPIYGVELFDGETARFEVEISEDDVRGQWKLNGETLSPSSDVDIIEEGAKH
TLILYNCKVSMTGEVAFAAANAKCSANLKVKELPLNFLTPLSDVQVYEKDEARFELEVSR
APKTFRWLKGSQELQSDDKYEMIQEGNMYVLMIRSAAYDDEAKYMFEAEDKRTTGKLVIQ
GIRLEFVKPIKDVTVKERETAEFSVELSHDKIPVVWYKNDVRLHPSKVVHMSDHGKIHTL
AFKEVTIDDTSMIRVEAMDKTVTAMLNVIEGDLYFTTKLHNYTAVEKDEVKLVCELSKAV
ADVKWFKDGKEITPSKNIAISTDGKKRILMVRKAEKANIGAYTCDCGSDKTTANLNIEER
DIKVVRPLYSVEVTETETAKFETEISEEDVHGNWKLKGEALHQSADVEIKEEGTKHMLIL
YNVRMDMAGGVDFSAANAKSNAQLRVKARSIGLMRPLKDVTVTAGETATFECELSYEGIA
VEWFLGGQKMEASDRVKTRVAGRVHALTVRDVKLSEAGEVKLTAKDFQTQAQLIVREPPV
EFTKPLEDQTVEEEATATLECEVSRENAEVRWFREGQEIRKTKKYDLIVDGRKRALVIHG
CSPEDAKMYTCDAKEFKTSCFLEVTPPHVEITKPLQDVEVREKESAKFECEVSRESAKVR
WFKDGSEIRRGKKYEITAKGVQRILIVHKSVFDDEAEYECDARTSKTSGMLTVIEEAARF
TKNLSNVEGTETDSVKMICEVSKANADVIWYKGDEELPEGGRYDQIMDGRKRILIIQDLR
MEDAGEYNCRLSPTVKTSATLKLNELAAEFIARPQNQEVVEGEKAEFACSVSKETYEVKW
FRGDKEVEAGDKYTIIIEGKRRALIVKNCELKDEGGYVAHIGSVKASADLCVIEKLRIIT
PIKDTEVKEGSEIVFNCETNTEGAKAKWLKNEETIFESSKYMMAQRDNVFSLRIRDAQKA
DEASYTINLTNHRGEHAKSAASAKVAEEKLKFLEPIEDIETQEKKTISFICKVNRPEVTV
RWMKAGQEVTLNKRIVYRADGLKHTLTIKDCVMDDEGEYTAVVGDDKCAAELIISEAPTD
FATQLKDQTITEFEDAEFTCKLSKEKAVVKWYRNGREIREGPRYHMEKEGKICRLIIKVC
RPDDESEYACGVDERRTRARLFVEETPVEIVRPPQDAFEPPGSDIVFEVELNKDRVEVKW
MRNNMIIVQGDKYQMISEGKVHRLQVCEIRPRDQGEYRIVAKDKDARAKLELAAVPKIKT
TDQNLMTDAGKPFVMTVPYDAYPRADAGWFFEGTSLPVQNIDTSADKTEYRLKSPSKEDQ
GRYKVVIKNKHGEGEAFINLDVIDVPGPVKNLRVVDTADGEVSLAWEEPESDGGSKIIAY
VVERRDVKRKTWTLATDRADVPEYCVSGLHKDSMYLFRVCARNRVGSGPTVATEDAVQAK
NKFDVPDAPENVAVANVNKFGATVTWEPPKFDGGSEITAYVIELRDRTSVKWEAALVCGA
NDRSAALNDVVENKEYIFRVRAENKAGIGRPSAATNPVKIMDPIERPSPPLNLNFSDQIK
SAVTLTWETPTSNGGSMITGYIIEKCDEGSDKWLRCNARLCQDLSYRVSGLKPGQKYLYR
VCAENAAGVSDPAEQLGPLVADDPHVGPTFDLSAFRNGLEVIVPHPLTIRVPITGYPTPV
AKWTFGEKELTTADERVSMVTKPTYTELTVTPSVRPDKGTYSLQLENDVSSVSGEIEVNV
IACPSAPKDFKVAEVTRHHVHMMWEAPEHDGGSPVTHYQIEKREVSRKTWAKVATGILDL
EHTVTDVIEGKEYLFSVTACNKCGPGEPAYIDEPVNVSSPATVPDPPENLKWRDKSAKTI
FLSWEPPKYDGGAPIKGYVVDKCQRGTDKWEPCSDPIPELKFQVTGLIEGQWYAYRVRAV
NKLGASRPCRATDEIQAVDAKEPPEIQLDVKLLAGLTARAGTKIELPADVKGKPDPRVKW
TKADLVLRADNRITIDTEPGHSKLSIADTTRGDTATYIIEAVNTCGRATATIDVNILDKP
GPPAAFDISEITNESCVMAWNPPRDDGGSPITNYIVECRQLDKEEWVKLSATVKHTTFKA
CKLTAMKEYVFRISAENQYGIGAPAEHVPIIAKYSFDPPGPPTRVTPSDIAKDAVTLTWF
EPDEDGGSPITGYWVEKFDPESDKWIRCNKLPIKDTTFRVKGLPTKKKYRFRVLAENLAG
PGKPSVETDPVLIKDPIDPPWAPGKPVIRDIGKTTALVAWTRPEHDGGAKIEGYIIEFQK
TGSEEWIRIAEDIPLTEHQLHGLMEKQEYSFRVKAVNKAGESEPSEPSDPVVCKERLYPP
SPPQWLDVTNITKINADLKWQAPSSDGGSPITNYVVEKRDVRRKAWQAVDTTVKDLKYTV
SPLNEGSLYVFRVAAENAVGTSEFCELEDAVLAKDTFTTPGPPYALTVVEVTKRHVELKW
EAPKSNGGRPITKYVIEKKEKLGTRWLKCCKTPDKQTQFKVTDVDEGSEVQFQVRAENEA
GVGDPSEPTEILTIEDATSAPSPPLEVAIPDASREHINVTWKPPAKDGGCPITGYHVEVA
EARPELKWLRVNNRPIKELKFRIDDGIKPEKKYVIRVRAINSVGVSDPSEISDKVFTKDP
DCAPTMDLEAQDVVVVEGEKLHLNIPYRAIPTPKMVWQKDTVECKADDRLSMTVEMNSAH
LELLKCTRADAGAYAITLENSLGTATGTVNVKVIGLPGQCKDITSSDVTKNSCKISWEAP
EDDGGTSIVSYTLERREASKKTYMPVMSGENVLTYTVKELFINCEYYFRVKAVNKVGAGE
YLELRNPVITEEIKQKPDPPIQVEAHDPTSKSITVTWKAPDYDGGCPIQGYIVEKIEKDG
DRYERVTPSLVPGFSYVVTGLKEDMEYQFRVRAENAAGVSEPSRSTPLTKAADPVEKPKV
TLHARVQSGVCIKKGEEIRIDAFISGSPYPKVTWLKNDEDVTKEPTKKIVPLVKKKKSKA
KVPEPEEEFVTPLRERLGLDQTQKGRSALMIRDAVRPDHGNFIIMVENTHGVATASCNVN
VLDKPGAPINFTFDEIRNTSVICNWEPPEDDGGSEILNYILEKKDNRNDEIGWITITSTL
KGTSCPVTKLIEGKEYIFRVTAENKFGCGPPCISEPLVAKNQFNPPDAPNTPRVHEVTAS
TVHISWHEPKDNGSPILGYWIERKEVNSKHWTRVNRALLNSLDVKVTGLMEGLTYIFRVC
AENLAGPGPFSEPTERIITMDAILPPGPPTPWIVDTGKDSVIVAWKPPLYNGGGDILGYH
VEKVLAGEKDWTRSTEFRCKELTYTVTGLAEGADYYIRVIAVNDAGPGAPGVTEPVTVKE
PQEPPAVDFDDSVKKGVMIKAGESLRLPAVVTGRPQPEVKWAKDEADIDKERMIVETVGK
NSTLFIKKAVRADHGKYKISGTNSSGTKTAETRVDVMDVPGPVVDLKTVVVTKKNITLTW
SDPLDNGGSDIIGYEVLRKDAKMKLFRQPIETASCKCDVQGLLAGEEYDFRVIARNKYGD
GAPADLGPILAEDPKGTPSAPEKLHYTDRSKTTITLAWQPPRTDGGSPIRGYYVEKMRSD
STEFDVANRKIFTECCGTIENLSENQEYQFRVKAVNEVGDGDPSKPITAKIQDDEIAPVI
TILKFFKTNAIIVRKGSAIDIPAEVKGLPLPTIQWMKDDVVIEKPDEEKMTMETEEVNRT
TLKTKIAIPETIRQDKGNYKLVAENCYGKAQHVITVEILDRPLPPRNIVVSDIKADSCYL
TWDAPEDNGGSEITNYIVERRDASKKKSDFDALTINLIDRRYGVYKLDLNGSYQFRIKAE
NKYGVSDGCDSEKVQLRDPFGLPGPPRNPKIIGATATTMTLTWEPPLENGGSTIQGYWLE
KRERGAVYWGRVNRAPVTKPAVKGLQYTVLRLIEGTEYQFRIAACNAAGVGPPSEATECR
FTVDPCNPPSSPGSPEVKDKTKSSITLSWSPPDRDGGSPIKGYIIEVHEEGSPDWRRVNP
TDKLHPSTEITVPDLKEGKKCKFRIYAVNAAGNSEPARTSDILIQDILIEPAVTLDISAH
DLLNCRAGTPIRIPATITGRPVPKVTWTFDGTAETEKKNELHTLPVDSEIHSTDTTSVVV
IPESKMNHSGRYVINAESPAGHKVVKVRVNVLDLPGPPRDVKVSDVTRGTCRLTWKAPES
DGGDRVKSYFIEKKTVGGKAWTKVNTACASQSLVVPDLIGGQEYLFRIRAENRFGFGPFV
ETTESARARDPIHPPDPPTRLKIQNVRKGTVTLTWKAPKNDGGSPVTHYSVDLLCWAASG
EKESWRRCNRRDVDTTTFKVEDLTEGDEYEFRVVAWNEAGHSRPSSTAGPILIQDQTCAP
SIELKEFMEVEQGSDISIVAKIRGCPFPTLTWYKAPPHKSDNKVEVQYDEHINKIVSDDS
CTLLIQQGKRPDTGLYTLVASNSIGKASKEMRLNVLGRPGPPSAPIKFEEIGAEKITLSW
LPPKDDGGSKVTNYVIWRRVANRKTWVPVTNEPKERIWTVENLMEGHEYVFRIMAQNKYG
VGEPLDSEPEVARNRYTVPGQCEKPTVTNVTMDSMTVNWEEPEDDGGTPITGYWLERKET
TGKRWTRVSRDPIRPMGMGESFVVSGLIEGSQYLFRVSAINAAGPGLPSPPTDPIFARDP
ISPPSPPTPKVSDWTRSTVDLEWIPPLKDGGSKIMGYWVEYKEEGTEAWVKAKETEIRGT
RFVITGLKTGGQYRFRVIAFNAAGNSEPGEVPEVLEVNDRTIAPEVDLDASVKERMVVHA
GGVIRIIAYVSGQPSPEVTWSRDGAALPPEAQVETTAISSSLVIKPCARKHLGVYTLTAK
NAGGEKKKNITVEVLDVPGPVGIPVTAENLSTDSCKLNWFFPENDGGSPISNYIVEKREA
ERKAWTSVSFTASRQNAIVHGLTTGKSYFFRVAAENAIGLGPFMETACELLVKEPISVPD
RPEELEVTKVTKDLISVTWKAPKYDGGSEITMYILEARMIGKDKFTRLTKEKLMDRKYTY
DGLREGDTYEFRVIAVNEVGPSKPSFCTKPITCKDELEPPTIELDFRDKIIIRVSESCLL
QGRYTGKPSPSIVWYRDDNELKADKHIMFKNTLTTMSLGLMKAERKHSGRYMVVVENSTG
SRKGLCNVTVVDRPTPPVGPVVFEEVHREYMVISWKPPLDSGGVDVSNYIIEKRDTNRDI
WTTVTSATTKTTCKIPKLTEGREYILRISAENMYGISDPLESEEMRAKDLFRVPEAPDMP
TVREVYATNALVLWNRPRDGGKPITNYILEKKEPTAKRWSRATRDPLYPATQYRVQDLVE
GCEYEFRVMAENELGTGDPSVPSKPILAKDPIVCPSPPVTPEAYDKTKDTVSLKWQMPRH
DGKGRIFGYIVEYQKPGAVEWVQANETPEQCPDLHYVVTGLTDGQEYTFRIFTVNAAGRS
DPAYVKQSIKVHDRLEEPELLLDANMARDHLAMVGADITLSATIKGVPTPTVSWKKNDGD
VPSHITVAVTGTGSKVFIPKCVRTDSGNFTITAENAAGKKSATVAVLVLNKPSPPRDLVV
SEVTSESAYLTWKAPEDNGGAVISHYVVHKKDVAAEQWVPVAPANKKLSLMAMYLMEGIQ
YLFRVAAENQFGRSDFVMTKTPIKAIDPLYPPGPPKNLHHTDADKTEVWLAWQWPDRTGG
SEITGFIVEHQEEGQTDWVTFKTVSNNHAHVTGLEEGKTYRFRVKAQNAIGVSRPDTSVP
ITCQEKTLPPTIEVDVKLIEGLVVKAGSNIVLPAKMTGIPIPTAKWMTDGNEIASEGHYH
IESAGSSTILSIPECKRGDTGEYILTVSNPAGSKTVALHVTVLDLPGPPIGPINILEVTP
DYMMIQWRAPKDDGGTPITNYVVEKKDVKKPWEPWSVVSSSGTSTKAKVSRLEKGREYIV
RVRAENKIGIGAGLESPPTVAKHMFNPPGPPGLPECSDITENAVTVQWSLPEYDGGSPIS
GYVIERREMTGKWIRVNKTPVLDLRYRVSGLFEGNTYEFRVFAENIAGISEPSPTSDPIK
ATRAITKPGPPGNPKLRDWSKSYADICWTKPTRDGGSPILGYVVEAQKTGTAQWDRINKD
LIKMCAYRVPGLIEGMEYKIRIRATNKVGDSEPRELPQTILAKDILVPPEVVVDVACRDS
LTVRAGQIISLITRVKGRPDPEITWTKDARALSRDKRTEINNNYPLCELVINEAVRSDYG
KYAIIAKNSSGQAQATIIVNVLDTPGACQNIKVAYVTKNSCMVSWENPEDNGGTEITQYI
IESRQPSQRGWTVVSNDCTKRLIKAPLTEGCEYFFRVSAENKIGAGPPTETKTPVLAVDP
IEKPGEPIDFHISEIGKTFCFLKWRKPDYDGGSRNLGYHVEKKPKEAEEWERLHKGAIKE
TYFMADRCIENQIYQFRVQTKNEGGESNWVTTAEVLVKELLVEPEIKIKLDGTLVVKAGD
SIPIEATVKGKPQPDVKWTKDESTEEIRKGPRLQIETGADFSKLLLTGARRTDSGKYVIT
AINSAGTGTAHAKVNVLDRPGPIRDLKVSGITTDRCHLAWEIPEDDGGCDIYNYIIEKCE
TKRGVWSVHSNAVITNKAKVTRLIEGNEYIFRVRAENKMGPGPAVQSGSIVAGTQFSVPD
APEAPEVTKIAKEEMTVQWSEPEKNGGKPITGYLLEKREEHAVRWSPVNKDPVPGTRFTV
TGLLPLHDYQYRVKAVNEIGIGNPSKPSRAITAKDAVEPPAPPTNLKVMDSTKSSVTLGW
TKPVSDGGAPLIGYVVEMRAQGSAKKGDDGWKRCNVAAQLVVCEFTVTSLDEKLAYEFRV
SAQNQVGMSLPCDLEGAVIPKEILEAPEIDLDASLKQGLTVRAGCPIRLCATIRGRPPPK
VTWRRMGIDNVVRKGKVDIIDTMTFLVIPDSTRDDSGKYCLTVQSRAGEKAVFVNVQVLD
TPGPVMNLEATDIKQTSAMLSWSPPDNNGGKEVTHYIIEKREIDRKTWATVKAEVEKDKV
PFKISGLMPGTEYYFRVTAVNEYGSGVHRVTPTSYMASDPVSKPDPCEKIEVLEITKNSA
TVGWVKPLRDGGAKIDGYVIEYIEVKPPPEPPAPVEVPEGEEAPLPPPPPPVVVEEEEEP
EKEVWNAYTTVKGLTISISGLKEGKRYKFRVAAKNIMGMSSFTETREPIEIKEQMLEPKI
VMPETVSARAGAKLRVEALVSGKPAPTCKWMRGENTVVPSSRLAVHQSGNLCVLIIKDVS
RTDSGEYSLVAENSSAKVVQALKIIIRDIPGPPEGPVEISDIDSDACSLSWNKPLEDGGS
NITNYVVEKCDVTRGDWVTAVSSCSKTNCRLGKLIPGKEYVFRIRAENRFGVSDPIQSDR
MVAKFPFDVPSEPLNCHINKTNKDCMFVAWDKPETDGGSPITGYYIERKERNSLLWVKAN
DTVVRTTEYPCAGLIEGLEYTFRVSAINRAGQGKPSKKTDFVTARTPVDTPGKPEILDVT
KNTVTLVWTRPKNDGGSKIIGYYVEAMRVPGDHWIRCNTSSQNVPREEYTVTGLERDLQY
QFRVIAKTAVNISKPSEPTDPILVCAENVPPRVELNAKMQKGIKVKAGATVLLEAEVFGK
PMPRVTWKRGDDSLKSGEGQVITHQRHHFQLEMTGVTKEHTGTYTILAENASGSKTAEIQ
INILDVPGPPASAKFLEVSATSIKLSWEPPLKDGGAPITSYIVDKRETSRANWALVCAKL
KGDILEYNVERLIEGREYQFRIRAENMWGVGDHLITNPVIAKNPFTVPGPCEAPVITNVT
KDHMTVSWKEPADDGKSTILGYMLEKKEAKDLNWTKLNRKPLTERTLDVTGLTEGTEYEF
RVIAVNVAGLGKPSEPSAGTYAQNPITPPGPVVNPSVTDTTNSTISLTWTAPANNGGSPV
IGYLVECKRTDTADWIRCNVPRNLQETNYVIQNLIHKAEYQCRITAVNKVGFSEPVEVPG
KHIAKDIIVPPEAELSAELKEGLELRAGSTMRLHATIKGRPNPKITWAKMNTNIKDRQGI
IIKSTNADTTVMVENVNRYDAGKYILNLESLAGMKMYTIVVKVLDTPGPPVNLVVKETSK
DSASIYWDTPLIDGGYEVTHYIVEKRDTERKAWSIVSNNCAKTAFKVPDLDAGRSYCFRV
SAVNKLGAGECCETADSVRASEEPGPVMDFKTLLVTKDSCTLSWKKPLTDGGSRIICYVL
EVLNGEDKYKELMRSKNMQYSAKDLVEGKEYNYRVKAVNDTGESAARELTVVAKDQIIHP
TCDLRDLPDMCYIAKEGSTVRLKIPIIGKPTPKVSWKKGDDEDLTDTGRVCAESSAVNTT
LLIRDCQRSDASKYTITLRNSAGSKESTIFIRVVGKPGIPIGPVKFKDVTADGATLKWGA
PKDDGGSEITNYILEKRDSITNMWVTVSSTVETNTMRVTGLHEGTEYIFRVCAENKYGVG
EGLKSEPIVAKHPFNVPDAPPPPQIVSMRHDSAYLAWSDPRKTGGSPITGYHVEFKERNS
MLWKRASPAALRMKEHKVTGLTEGLEYEFRVMAINLAGIGRPSAPTDPQVALDPIDAPGK
PDVVSITRSTVTLQWTEPQFDGGHRLTGYIVERRDLPSKIWVKANNVNVVEPAFTVTDLQ
EGCKYEFRIRAKNAAGALSPPSEQTDTIICRDEYAAPTIIIDAQVMEGLTVRAGDTIVIT
ATSILGKPAPTSCWSKGGKYFKPSDIVQIETTATSSTLSIKYAGRKDSGDYTITASNPFG
VKEETVKVKVLDVPGAPGPVECSGISSEKVTLTWTAPTEDGGSPIKYYTIEKRETSRLLW
TVLEENVINCHYVANKLIQGNEYFFRVSAVNQYGASEPSHSEAVKMVDRFGPPGPPSKPE
VDKVDGHSVTVKWRRPAEDGGSDIIGYCVEKKEKKAMGWVRASKKSIAELSYEVTGLTEG
VEYEFRVLAENKAGFGEPSEPSMPVRTIVVAYVPGPPVNPRVTDTTKTTATLNWGKPLDN
GGLQVTGYVIEHKKEGTEEWIKDTPSSLLRITEFVVPGLETGAKYHFRISAVNAKGAGEP
AETQELVEIVERAAEPDLELDVELRRTLVVRAGCSIRLFVPIKGRPTPTVTWTKEGGPVP
RAVIDTTESFTMLLIPESSRIDAGKYELTLENSAGKKSADIHVRVLDSPGPPLNLKPIKI
DKESITLQWEMPLIDGGAKITNYVIEKRESTRKAFATAVTNCPHTSIRIGDLGEGCEYYF
RVSAENEYGIGEAVETTDPIRASQAPTPPESIIPTDVTKSSVSLAWTKPKHDGGSRITGY
VLEAQKKGTDQWAHVTTVKAMDFTVKNLNENEEYIFRVMAVNHSGRSAPRESKPIAVKDS
TSLPEFDLRGVCQKIVIAKAGDDIKVEIPVMGRPRPTISWQKDGAALKLTQRTNVETTAA
TVVLSINECNRADSGVYTMTGKNIVGSVIDNITVKVHDVPGPPKGPIKIVEISRTYCVFA
WDTPENDGGVPINNYVVEIRDTTSQTWTELSSTVIRTMFKAIRLNTGSEYQFRVKAKNRY
GVGPPITSAAVVAAYPFKVPGPPGTPSVVAFTKDSITIGWNEPVSDGGNEVIGYHVERKE
RSSIIWHKISKGIVKGNIFKTTGLEDGVAYEFRVMAENMAGIGKPSKASEAILALDPVDP
PGQPVPIFVNKNVITIQWTKPEYDGGFKITGYTVEKKELPAGRWIRANFTNIIETTFTVS
GLTQDASYEFRVIARNSAGAVSVPSDPSDPIICKDDIIEPRIMVDAIFKDVVLLKAGESF
KLDADIAGQPTPSMVWTKNGKEIENTMKLDVKFTELTTTLTNKDSVRSDGGEFVLTATNV
GGFAKHIFNVKVLDRPGPPVGPLKVSDVTADNCVLTWAPPADDGGAKIEGYVVEKRESSR
LVWTNVVSDLQTTQYKVAKLLKGNEYIFRVMAVNKYGLGESLESEPTIADNPYVVPDPPE
NPEVTAITKDSMVLMWQAPKSDGGTPITNYNIERKDRIGLRWVKCNKRKVKDLQFKAAGL
VNGHEYEFRVIAENAAGVSAPSVSSPFYKATDGLYKPGTPCNPRILDTTKSSITVAWNKP
VYDGGSDITGYIVETCIPSEKEEEEEWTIVTPKEGLIATSFTIINLKENQEYKINISAVN
SEGIGDAASVPDNTKAEDRLLPPEMDLDAELRKVVSLRACCSLRLFVPIRGRPAPQAKWT
KGDGEPIERATIDSTTSYTSLVIENVNRFDSGKYNLTIENSSGSRTVTVQVRVLDTPSAP
QNLKITAVTNEAVTLTWDPPVNDGGVKLRTILLKNVSRQGKHTPRSMLYVIIPPSQLASS
WKDAIITSEFWPRMNMALACPLRLVNQLKCLRNHSHLAKSLLRMLPKTVSPSPGRSQSMM
VAAE
NT seq 52395 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacacaagcaccaacgttcacacagccgctacagagcgtcgtggcactagagggt
agtgccgccacgttcgaggctcaagttagtggttctccagttcctgaggtgagctggttc
cgtgatggccaggttctttccgccgccgctctgcccggcgttcagatctcgttcagcgac
ggccgcgctgttctgaggatccccgctgtgaccgccgcacacagcggaagattttctgtc
agagccaccaacggcgctggacaagccacaagcaccgccgaactccttgttacagcggag
acggcgcctcccagcttcctacagagactgcagagctccacagtgagacagggcagccag
gtgaggctggacgtccgagttacaggtatccccgcacctgtggtcaagttctacagagag
ggagccgagatccagagctcggccgacttcaggattctccaggacggagacctgtacagt
ctgctgatcgctgaggccttcccagaggattctgggacttattctgtgaccgctaccaac
agcagtggacgggccacctccaccgcagaactgctggttcagggtgaagaagccgttcca
gctaagaaaaccaagacagtgatttcaacctctcagatttcacaatcccgtcagaccaga
gtggaaaagaggatggaggccagtttccaggcctccgccatgatgcagatgcaggtggag
ggcgccgagctgactcagcagctggctcacaagactccgcccagagttcctccaaaaccc
acatccaagtccccgacccagcactcgctggtcgccaaggtgaccggaggacggcaacag
tcaccatcacccgtcagacacgtgaaggcgcccacgcccacaccagtcaggcctgcctct
cccacttcaagactctcagtctccccaatcaggccggtcaagtctcccatcaccacgcgc
aaacaggtggctgtcggcgctgatgtcctgccaccctggaagcagggagactacatggcc
gaggccagctacaccagcatgaccagtatgaccagtatgaccagtatgaccagcagcact
gtcacccagctgggccaggagcagcactgggagcagcaggtcaccggggtcaaagaggct
gggggagggaaaagagccggggcggtggccaaagtggttgccgccgttgacctggctcgt
gtacgtcagcccatgcatgtcgagggcggtcgagctgaagaggaggaggccgtggaggca
gaattaaggcagcagggcatcgccaccgccgccgctgccgcctccacggctgctgatgaa
cagtatcaagccggatggacaacaacaagagtgcaggctggccaaatgcttactactgct
caggcgtttgctcctgaaccaaccctggcactgcctcagattcagagagcgacagaaatc
tcctcccacgtggacactggtctcgccccgtccccagttccacatttcacagtttctaaa
gtttctgtcccaaaacctgagtctagctctgaggtttccatcgctggctcagccatcgcc
actctgcagaaagagttatcttcatcctccgccgcggctagaaagatcatcaggcctgtc
aagtctcccagtccatgtagagtggcagagaccagagtgacgccagagcccatccctcca
ccgttcaaagacttctctgaaaaatatcagagtcgtcttggcactgagttacagaggggg
gtggtgagctcggggggcatggagagagtatatgaggactgggcagtccaggtggtggaa
gtagcagctgtaccttctgcaggtgatggcgtggtcccacccacactgatgtctggcttg
aaaaacacaaatgtgacagagggtgagtcagtgacactggagtgccagatcagcggtcac
cccgcccccgtcatcatgtggttcagagaggactataagatcgagacatccattgatttc
cagatcagctacgagagtggatttgcccggctggtgatccgtgaagcgttcgctgaagac
agcggacgctttacctgcaccgccactaatgaggcgggaacagtcagcacctcctgctac
ctgctcgtccaggtgtctgaggacatcgagagcagagaggagatcactatcgtcaccgaa
catgttgaaactgctcaagagaaactagtaaccgaagaagccaaagaagaaaccatttct
caggtgagcgtggccgagtcagatgctgctgccgctgctccatttttcattaagaaacct
actgttcagaagctggtggagggaggaagtgttatatttgaatgccaggtcggcggaagc
ccaaaaccacacatcatctggaagaagagtggcgtaccactcactaccggatacagatac
aaagttgcctacaagaaggagactggagagtgcaggttagagatctccatgaccttcgct
gatgacgccggagaatactctgtgtttgccaagaaccagcttggagaagtctcagcctcc
atcaatctgctggaggaagaggaatatgaagcctacatgaagaaagaggaagcatccttt
aagactgaagtgacagccatggtgcaggagcccaaagtgggagatgttcccccagttgtt
gttacaaccacggagcagatgaccactaccattatctcaggacaggaattccatctttct
gctatcgagcagaggataatccaagagattgagctccgcatcatgaagattacctacaga
gagatcgtgacagaggatggagagttgatggtgactgctgcccccacagaggccgtgcag
cccgccttcgacactcctgtcaaaaactacaggatcatggaaggaatgggcgtcactttc
cactgcaagatggctggaatgccgctgcccaagattgcttggtacaaagacggccagcgc
atcagagctggcgaccattaccagatggaagttcttcaggatggacgagccagccttcgc
ttgcccgtcgttttgcctgaggatgagggcgtgtacaccgcctttgctaccaacttgaaa
ggaaatgccgtcagctctggaaagctctacgtggaggcatctggagctgcaccacctcaa
agatacacaccacagccagcagtgcagaggataaggtccacatctcctcgttctctgagc
cgctctcctggtcgctcctccagccgttcacctggacgttctcccgcccgccggcttgat
gagacagatgaggctcagttggaaagactctacaaacctgtgtttgtcatgaagccctcc
tcatacaaatgctctgaggggcaaacggccaggttcgacctgaaggtggtcggcagaccc
atgcccgacacatactggttccacaacggacaacaagtggttagcgactacacgcacaag
atagtggtcaaagaggacggtactcagtcattgatcattgtcccagccatgccgcaagac
tctggagagtggacggttgtggctcagaacagagctggacgctcatccctctccgtcact
ctcacagttgatgctaaagaaactttggtgcgaccccagttcactgacaagctgaggaac
atcagtgtaaagcagggaactctggttgaattggctgttaaagccattggaaaccccctg
cctgatattgtctggctgaaaaatagtgacattatcacaccacacaagcacccgaacatc
agaattgaaggaaccagaggagaggccaaattccagattccctcagcagctggcccagac
agtgcctggtacacagctacagccattaacaaggctggtagagacacgactcgctgcaga
gtcaacgttgaggtggactatgctgaacccgaaccagagaggaagctcattattcccaaa
ggaacctacaaagccaaagaaatcactcctccagaggtagagcctcttcatctacgatat
ggtcaagagcagtgggaggagggcgacctttacgacaaagaaaagcagcagaaaccgctg
ttcaagaagaagctgacctctgttcgcatgaagcgtttcggtccagctcattttgagtgc
agactgacccctattggtgaccccaccatggtggtggagtggctgcatgatggcaaaccc
ctggcagccgctaacaggttgcgcatggtcaatgaatttggctactgcagccttgactat
gaagttgcttacgctagagacagtggcgttatcacctgcagagcctcaaacaagtttgga
gttgaccagacctcagccaccctgatcgtcaaggatgagaagggtcttgttgaagaatca
cagcttcctgaaggcaggaagggagcgcacagaattgatgagattgagcgcatggctcat
gagggaggaccctatggagtcactgctgaagaagaaactgagaaactgaaacctgagatt
gtacttcttcctgaaccagtcagtgttatggagggtgacattgcacgattccgctgcaga
gtgaccggttatccagcacccaaggttaactggtaccttaacggacaacttatccgcaaa
agcaagagatacagacttcgttatgacggtatttactatatggaaatcactgaaatcaaa
tcctatgattcaggagaggtcaaagtcatggcagacaacaacctgggctcagcggagcac
actgtgaagctggagattaaggagaaagaggacttcagaactcatctgcgccgtgctcct
gaggctaaggcagctgaggctgcacctgagcttggaaaaacaccattcgaggtggtgaag
gctgagaaacatgcagaggattctcacctgaaagaggtggtcaagctcaagaaagcccat
agaatcgtccatgagaaagccacagaggagactgaggagctgaggagcaagttcaagcgc
aggactgaggagggctattacgagtccatcaccgcggtggagcttaagtcacgtaagagg
gatgagtcctatgaggatctgctgaagaaaacaaaggaggagctgctccatcgtgccaag
gaaaaggaggaggctgagaagaagaaggaggaggagcgcctcaaacttacagctaaacct
ctaaaaccagagagggtcaaactctcagccagtatggaagctccaaagatcctcgaacgt
attacaagccagacagttgcacagggtgacgaagtcaagttcagagtcagagtcattggc
agaccagaacctgagtgtcagtggttcaagaatggtgttcagttggagaagtctgatcgt
atttactggtactggcctgaggatcacgtgtgtgaactggtgatcaggaatgtcagagcg
gaggattctgctagcgtcatggtcaaagcttcaaacactgctggagagacttcaagccat
gctttcctgctagttcaagcaaaacaagtcatcaccttcacacagaagttggatgacatc
aacgccaaggagaaggacactatggctacctttgagtgtgagaccaacgagccttttgtc
aaggtcaaatggctgaagaacaatgaggagatcttctccggagacaaatacaggatgcac
tctgacagaaaggttcactttctgtctgttctgatgattaacatgagggacgatgcagaa
tatacctgtgtggtcatagatgatgacgtcaggacaactgctaagcttaatgttgaagga
gctcccctggagatacttaagcagctggagagcacagaggtgccagagacatactccgga
gaatttgagtgtcttgtgtctcgtgaggatgcagaaggcagctggttctttggagaaaag
ctgatatctcccagcagtaaatacgtcatgtcctcccgtcgtggaagacacaccctgtct
gtcaaagacgtcaagaaggaggaccagggaaaatataccttcaaagtgggcgagttcaag
acaagtgcctcactcaagatgaaattgcgtccagtaaccctgatgcagcctttgacagac
ctgacggtctgtgagggcgatattgctcagttggaggtgaagttctcccaggagaatgtt
gaaggaacctggatgaagaatgggcagcctgtcacagcctccaaccgtgtccacattgtt
atcgacagacaaatccacaagctcctgattgaagacacccacaaggacgactttggaatg
tactcatttgtcgttcctgctcaggagatctcaacctccggaaagctggtcattcaaact
atcggtgtactgatcccactgaaggacactcaagccattgagggcaccaaggttgtcttg
gagaccaagatctctgctcaggacatcagctcggtcaaatggtaccacaatgaccaactg
gtgacacccagtgaccgaatccagatggtggcaaagggagccaagcagcgtctggtcttc
aacaggacctatgcctcagatgaaggacactacaaactggttgttggccgagccgacacc
agctgcaaatttactgttgagactgtccagatcgtgaccccaatgaaggacaaggagtgc
tctgagtctgagaatgtcacctttgaagtcgaggtttctcacccgggcattgatgccttc
tggaccttcaaaaggcaaccgctcaaagctggctccaagcataagatggagtccaagaac
aaacgccacatcctgacagtcatgaatgcaatgaaggatgaggagggcgagtacatgttc
gcagctggtgagaagatgtgcagtgcttctctcactgtaacaggtggtgctatcaggaag
cctctccgagatttggtggtggctgactcccagactgccgtgctggagtgtgaagtagcc
aacccgtctgcagagggcaagtggctgaaagatggccagtccgttgatttcaacgagaac
gtggtgagcgaggtgaaaggcgctgtcaggcgcctcgtcatcatcatcacaaaagccact
gacatcggagagtacacctatcaggttgccacctccaagacctcagccaacctgaaagtt
gaggctgtgaaggtcaagaagacccttaagaaccttaatgtggtccagactcaggaggct
gtgttcagcctggagctgacccatgaaaatgtgaggggagcacagtggatcaagaatggt
gttgagattcagcccagtgataaatacgagatcaagactgaaggcacagcccacacccta
aagatcaagaactgtaccgcacaggacgagtctgtttactctttcaaactgggaaaactg
tctgcaagtgccaggctgaatgttgaaactatcaagatcctgaagaagccaaaggatgtg
acgtcactgttgggcgcaacagcttcattcgaggttggcatctctgaggacgacatccct
gtgaaatggatgtttaacaacgtggaactgaggccaaacgagcactacagcatactctct
gagaaaaagacccacaaactggttgtccagaatgtggacaacagcaaagagggagtgtat
accgctgtggtgggccacctgcagtgcaacgctcgcctcaccgttgagtctctgcgagtc
accaaacccatgaagagcgtggaggtcccagagactcaggtggccacgtttgagtgtgaa
gtttctcacttcaacgtgccgtccacctggctgaaggacggcgtggagatcgaaatgagc
gagaagttcaggatcgtggttcaaggaaaactccaccagctgaagatcatgaacaccagc
agggacgactctgcagagtacaccttcatctgcgggaacgacaaagtctccgcgaagctc
accgttaatcccattctaatcacgacgatgctgcagaacctgaacgctcaggagaaagac
acggtcacatttgaagtgaacattaactacgagggaatcacctacaaatggctgaagaac
ggcgtggagatccgatccacggacagatgccaggctcgctgcaaacagctcacacacact
ctgagcatcaggaacgttcactttggagacagtgctgagtacaccttcatggccggctct
gcagttactacagccaaactttacgttgaggcccgtgtggttgagttcaccaaacacctg
agggacctgaagatcacagagaagaagagggcaacttttgagtgtgaagtttctgaacca
aacgtgcaggtgatgtggatgaaggatgggcaggagctggagatatctgacagatataaa
atgacctcggatgaatttgtgcaccgcctggtcctgccatctgttcgcctctctgacgcc
ggagactacaccgctgtggctggatccagcatgtccaagggccacctggcagtcgaggga
cgggacatcaaaatttcagagcccgctagcaggaacatcactgtcgttgagaaagagaga
gcgaccttcgagtttgaggtggatgaggaagatgtggatggtcggtggatgaggaacggc
gtggagatccagttctcagtagaggaaaggttcaactatgccaccatcaggaagctccac
cgcctcaccatctctgagacgtacaggagcgacgccggggagtacaccttcttagccggc
agaaacaggagcaccatgaaccttcatgtcagattgccagagcctcctcagatcgtccgc
cccatgcagcctcagacggcgatgtcaggtcggtcagttcgcttctcggtgcaggcgtgc
ggcctccctcagcctcaggtcacctggtacaaggactcccaggctctgtccaccagctac
aagtgcaagttcctccacgacggagacgagcacacgctgctgctgctggaggtcttccct
gaagacgccactgtctacagctgcacggccaagaacgactacggagaggcgacaagctcc
gcctctctcaatgtggaagttcctgaggtggtcgaagctgcagctcgggtccctcctccg
gtcctcatcattcctgtacatgacatcctggtcgctgagggacaccgtgcccagttccag
tgcaacgtctctggggaagatctgcaggtttcgtggttctgtaatgacagagagatcaga
gagtcagacatcttcaggatgtctcattatggtgacacctgccagttggagatctccaga
gttctccatgagcacgaaggagagttctcatgtgttgctgcaaactcagcaggaatggtc
acatgtgccgcgaccttgaatattgatgtaactgcagtggagaaggaatcaatgattcag
gaggaagtgaaagtgaaacctgtgttcaggcacagaattgtccctatggagatcaacatt
ggcaacagtgccaagtttgaatgtgaaaccgaggacgctccgaatgtgagcttcaagtgg
tacaaagatgggcagtccatcaaagagggtgataagtacaggattatcagtcgcttcaga
acttcctctctggagcttctggcccccaccaaggaggacagtggtgaatacacctgcaag
gcgtccaatcaacatggcagtgatgaatgctccgcctctctcagtgtgacagagcaatat
cctcctgcctttgtaactaaacctgaccctcagactgtgtatgttggtaagagggcaatg
atacagtgtgtaataacaggatctgctcctctgaatgttgtctggctcaaagacaatcag
gacttacccaaagtgcctgcacaataccaaaccttttgtgaaaagaacaaacacaatctt
gagataaccacacttgaggcagctgacagggggctttatgtttgcaaagtgtctaataat
gttgggacggctgagtgcagcatggagctgcgtgtcattgataagcccaactttgtaaag
cctctgggtcctgtcgctgctgtggttggagctcctctgcatctggagtgtcaggtggat
gaggacactggagtaaatgtcacctggaccagagatggtagaaaagtccaccaatctcca
gactgtaaactgtcttttgaggataagacagtgacccttgatatcataaagacaacactg
aaagattgtggaaattttgtgtgtacggtggcaaatgaagccgggagcgcaacatgctcc
acttcggtgaaggtacaagagccaccagtctttgtaaagaggctggaagccgccacagtc
tggaagcaaggcagcacttcacgactgcagtgcaccatcaaaggatcccctgaacttcac
accacctggttctttaataacagtgagctgtctgctggaggcagatacagcatcagtctg
aagaatggtgtggccactcttgagatacaagaagtcatgttgagtgacagtggaaactac
acctgcgaggttctcaatgagtctggctgtgaaagttgtagcactaaagtaacagtgaaa
gagccaccatctttcaaaaaagagccgctctccatagaggcggtcagaggatctgtggct
gtgttggcgtgtgaactatcaggttcttcaccattcgaggtgtcttggaaaaagaataag
aaacgcctgaacacagataagaagtacaggataatgtcacagggagccgtcacctctctg
gagatccactcattcgagagtgctgacacaggggaatacgaatgtgtcgtatcaaatgag
gtcgggtcagtgacctcaaagtctgtggctaaacagaaagaaccacctatgttctcaaag
aggattgagagtgctacagcagtgttgggaaatacagtgaagctacagggaaccctaaaa
ggctcagctcccataacagtcaaatggatgaaagactctgagctgctaagagatgacgat
ccaaacgtcaaaatgaaatatgagaacaacatcacaagcatttccttctcctctgttgag
ataaaacacagtggcaagtacacttgcgtcgctgaaaatgaggcaggacagcagaagtgt
gaagcagtcttaacggttcaagaacctgctaggatcttagagaaagcagcgtccatcagt
gtgacgacaggggattcggccacattggagtgcaccatctctggaagcccagagctcaaa
gtaaaatggtttaaagatggtaaagagatgatcagtggccgtaaatataagatgatggtg
aaggagaacactgccaccttaaagatcctcacagcagagaaaggagacactgcagagtac
aagatggaggtgtccaataaagttggaaaagatcagagcacatgctcagtcactgtgata
ggtcgtgcagttccaccatccttcactaaagctcttaagaaagtggatgggaggatcggt
agtaacattaccttggaatgcagagtttctggatctcagccaatggttgtttcttggtac
aaagacaatcaagaaatccacagtgatgacaaatataagcttgatttcagtgggagtaca
gcttctgtactgataacaggcctggatcaaagtgatggtggagtttacacctgccaggcc
tctaatgatgctggggaaaaagaaaccagtggcactttgtccatcaaagaacctccagtc
ttcaccgtgaaacctgaatcccaggacgcttcaccaggatcaaacgttgtcatgaaatca
acctttacaggatcagctcctctggctgttaaatggttcagagaggagaaagaggttttc
actgggggaaaatgtttcataaagaaagattcctcttcaagctccttggagcttcactct
gtgaaacctagcgactctgctaagtacacttgccaagtgtccaatgatgctgggagggtg
gactgcactgcattactctttgtaaaagaagccccaacatttacaatgaagctggagcct
tcacagctgctaagaactggacagcccctgaatttgtcctgcaaagtgcagggtacccct
gtcattagcatcatgtggtttaaaaatggctcagaaatcatttcagaccacagacacact
atgtccttcgacagctcaatagcaactctggatgtagagaactgctctgtagaggacggt
ggtgattatgtctgtgcggcgtccagcgaggccggcagagaccaatgcagcagctcagta
acagtgaaagagcctccagtgtttgtgaggtcgtttgaatcaactgagcatgtgaaagga
tccgatattatcttggaaggaaccgtgtcaggttctgctccatttgaaataagttgtttc
ctcaatgataagccaatcagaaacgactcaaggcatcaaatcagtgtggaaaatgacaca
gtcactgttcagatttcaaactgtgcaaccggagacgctgggatgtatcagtgcactgtt
gcaaatgatgttggggagacatcttgctcttgccagatatcattgaaagaaccaccatca
tttgttcagagactagaggatatgtcctgcatggtgggctctgaaatctctctgaagtgc
atgttgtctggatcacttcccatgactttctcctggatcaaggatgatcatgagctcaca
gaagacgagcatgttaagatgtcccatgaaactaaaagtgccattttgaatttgaaaaat
gctcagttatcacacggcgggaaatatgtgtgtcaggcacagaacaaagctgggactcag
agatctgctgccgtgctcattgtgacagagcgcaaaatccctccaaacatcatcaagaag
ccctccgagtccatggtggattcagtgggtaaaactgtgacaatggaggctcgggtgtct
ggatcccagcccttgaacatcatgtggtacaaggacaacaatgaaatctctgcttccaac
aaatatgacatcagcttcaagaacaacattgctgtgctgtgtgtcggagactccaccacc
tctgacagcggggtgtacacctgtgaggtctccaacgaagctggaagagcttcttgtcca
gtttctctcactatttcagaaactgggcaggcaccaaagtttgacgtccgtctggagccg
gcatcggtcaacgagggggagaagctgagccttaaatgccacgtcagcggctctgctcct
ctgagcatccagtggatgaaggacagacgggagcttaagtccagtggaaataccaaaatc
acctttgttggtgggatggcttgcctggagatcagctcagtctcaaagacagacgcaggg
gattacctctgcaaggccagcaacgctattggcagtgacttctgcaagtccagggtcact
gtgagagacaaaggaaccaaggttgcacctgctgaggcccccaccccagctgcagctgct
ccggtcaaaaggcttgacaacctgttcttcattgaggagcccaagaatgtttctgtcaca
gagaagggcaccgctaccttcattgcgaagatcggtggcgacccaatccccagcgtaaag
tggatgaagggcaaatggaggcagatcactccaggtggtcgtatctctattgagcagaag
ggccagaacgccaaactggagatcagagaggtgaccaagtctgactctggtaactacaga
tgtgtcgccaccaacaagcatggagagattgagtgtagcgctgatatggaggtcaccaag
aaggaagaagtggagggtatcggagacatgaggaccagactgaagaagactccctccaag
cagaagagccccaagaaagatgaagaggtcgatattgtgtcgttgctgagaggtcatgac
cccaaagactatgagaggatactgcgagaacatggaatccacgactaccgggccatcctg
caggccgttgagttcctgaagagggagaaggagatggagactggaaaagtggaggtggag
catggtggtcgggttgaagaggaggtcatggcccaactcatccagcagctggagggacgt
gtcagcactgagccagtctctgtactggaggacatcaccgaccagatgatcactgagaac
cagagcgctacctttgagtgccagatcaggatcaactacccagagatcactctgacctgg
tacaagggcacccagaaactggacaacagcgacaagtacgacatcagcagcgtgggcgac
cgccactctctgaagatcaagaactgccaggtcaaagatcagggcaactaccgagtggtg
tgtggtcctcacatctccaacgccaaactgactgtcacaggcgtttactctgtgatcgct
cgtctggagccaatgggagaagctcgaagcacagctgagctttacctctcaggcaaagaa
attgagttaggaagggttcctcaggatgtcccagacacgtcaattcaagtaccagagaca
gagtctatggttgtttacagagattccacagaagtttatcactatgaagaaagaacagaa
gtgagagcttttgaaagtctgacagttgaagaagagacggtttctgttcggtactcctcc
gtcacagaagagaaaaaacccgtagaagaaattgttgagaggactcatgtcgggcagaga
gaagaaatccctaaagtccctgaggtttacgggagaccagaggagaaaccctctgagcct
gcagctccaccttcagctccagtcaaagtacctgaagtaaagaagccacagcctgaggct
cctgccactgctccacctcgtagggaggaacctgcagccccaaaagaaccctcagtatac
accaaacctgaacctgaaccagagatagttcccagagaggtcactcctgaaccttatcaa
cccaagccaaagacggcagagccaaaaatggttcctcctgagcctaaagtgacacctcat
aaactggcagcacctgagcccaaagtgacacctcataaaccggcagtacctgagcccaaa
gtgacacctcagaaaccagcagaacctgagcccaaagtgacacctcagaaacctgcagaa
cctgagcccaaagcggccaaaattaagcctgaacctgaagcaccaaaggttgaaactgtc
aagaaagcaccagaagttcctaaaccgagagtaccagctgtagccaaaccagaggaagcc
atagctcagcctcctgctgccaagattactccatcaaagactgaagatattttggtaaaa
gtaccagaaccatcaaagccagaggaacctgtagttcaaccaactgctgccaaggttact
ccttcaacaccggaacgtcttccgactaaagtgcaagatgtacccacaccagcagaacct
gtagttcaaccatctgcaccagaggttactccacccaaggctgaggctgttccaactaaa
gttgtctcagaacccaagacacctgagcctccaagaaaaccacatctactgactggtaaa
cctgagccagatgcaccaaggtacatccctgaaccaaaaccagaagaaccaaagaaggtt
cctgaagcccaaaagaagattccagcagcaccaaagaaggttccagaagaaccaaaaaag
gttgtggaagaaacaaagaaggttccagaggcacagaagaaggttccagaagaaccaaaa
aaggttgtggaagaaacaaagaaggttccagaggcaccaaagaaggttccagaagaacca
aaaaaggttgtggcagaaacaaagaaggttccagaagaaccaagaaaggctccagaggca
cacaaaatggttccagaagaactaacagaaccaaagaaactggcaaaggttccaaaatta
gtaacagaggaaccagtacctcaccacaaagaaccaacaccatcaccaccacaagatttg
gaaacaccaaaacaaattcttcaggctacaaagcctcagcaacaagttaaacagagggag
ataccacaggaaacatcagtactagctaaaccaaagctggaggcgggtacaaccaagaaa
gttcctttgaagactgatcttaaagaaacagtagtggttgaagacagaaaggagtcagtt
gtgatagaagaaaactctttaaaaatggacataagacaacaaattgttcttgaaaaggaa
gagcaagtggtttctacatggtacagtgaagataagcacgttgaagatgctgagccagta
gaggacattgagccagcatacatagaatatgaggatagaaaaccagaagataccgaactt
ttctatggagaagactttgctctcgaggaggaagctgtggaccagagagaagaaatatct
ttgaggtctgtctctccacctctaaagaaagttgcccctcttccatcaaaaagagatatc
acacctccatctcaaatgattcatccttcaaagaaagaagtttctcctcctgacactgga
atcacatccaaagaagaggcttacaagaaaactctttcagaaagcaaacaaacaatttat
acacaacagagagaagttactgaatcatttgtatttgtacatcgtgaagaacttgaagaa
gcagctgtctttgcattggaggatcgcgataaacctaaaatcaatgttacacctaaaata
gccactgtttcgaagaagtctagacctaaggacgtcactcttttgaagccagcagaggaa
gtggaagaagttccatctgacagatccatgtctccgcctcatagagaaactgtttcgcct
ccatcggaacaagacttacctggaattctgaccacgattcctcctaagaaagaagcaatg
ccacccaaaaagatgaaatctccaagggaagaaatcacgaaaacctctaaagctgcagta
aaaataaatcttgaaggcaatgtacctcttcagaaaccaactgctgtgccagaagtacca
tcccctgaagaacttgtccaagcaacaagatctcttccagttccagctcaggttctttca
cctgggaaagcagtctgtcttgaggaagaaatttcacccttaggggaaaccgaatcaaca
aagacctctcccgcacttcccaaaacagttgttgaggactttccctctgaagaagtgacc
ctatccaagaaacctattcataaagacagggttgctccaaccaaaaaatctcaagttcca
ccacagaaaaaactcttcccccctgagcaagaaactccaccacccaagaaacctacttct
tatacaccaaaaggaatcacccctcacactgattcttctgaagaagcaagaaccactgca
actaaacttgcaccaacaagagatgatgacaagaaagcaaagaagggaacacaggagatt
gatcaacaaactcttcagaaagtgtcccctccagaggagaagaaaccatctgtacctaca
ccaaagccttcgcctcctcctcctcctccttctgctcctgcacagaaagttgctcctcct
gcagtatctcccctagaggagaagaagccatctgcaccagtaccaaagcctgtacctgct
cgtcctgctcctgcagagaaagtagcacctgcagtgtctcctccagtggagaagaagcca
tctataccagcaccaaagccctcagctcctgctcctactgcagccaaagttgctcctcct
gcagtgtctcctccagaggaaaagaaaccatctccttcgacaccaaagcctccagcagaa
aaagttgttcctcctgcagctccagttgcagcagtggagaagaaaccctctccaccagcc
gtaaaagctgaaccctctcctgtatcggaggaaatctctccacctgaagacaagggacca
gtttcagcacctggaccaactaaagtgctacctcttaagcaaaagggtaagattcctgtt
caggaggcaaaaacacccgaatcaccgaagctgaagagtaaatttaccagaatacctaaa
gagaaggaaccagaaccagaaatcattaagctgaagagagttccagtgaaagctccagaa
cctgagaaacaggttctaactcgtaaagctcaagtgacaaagcatcatgatccagaacta
acagttcacggacttcacgacagagaagatcgagagataataacacttggaagaactgaa
cgagtcttcactgcagaggaggagacagttcagttaggcctatttgaggaagctgagaag
gttgcagtcatacagaaaacagagaaagaaggttggacaagaagcccaaaaccacagaaa
gaggaggaccctgaggcaccgagtgtagataagaagaaaataactaaattgccaaaggca
gatgagcagaaagaattagttaaactaaaaccatttgataaaccagggaaaccagaagaa
gaaccgcaaaagatccaactaaagaaggtgccaactaagcctaaagaacctgagaaggaa
gtcgtaactcataaagttgatgtaacaagacattatgatacagaactatctgttcagaag
cttcgggatagagaggatcgagaggtgataacacttggcagaactgaacgagtcttcaca
gcagctgaagaggcatctgaaatggaatctatggaggaaccggaacatctagaggcagaa
gatgagaaatcaagatggataagaacccctaaagcgccaaaagatgaagaacctgagcca
gatttaacaaagaagaaaataaagaaattgccaaagaaagaggaggagccagaagtagtg
acattgaaaccttttgaaaaacctcagaaacctgaggcagctgagcctccaaaagctaag
aaagaaggtgaagcaaaaacagatactgagcgtactccattcaagagacatgagatccct
cagagagatcaacccagtgctgctattaaacacagaaaagatgaagatattccctcgaca
agtccagaggtaattcctgatgtcagcagagaccagacagtgatcccacagaagaaagaa
attgatcaggtaccaaaggatgaggaacctacagctgccgacaaacttcgtggaaaacct
aaaactatttccacaccagataaagagaaagagcaggttgtgttaaaacctttcaccaaa
gatgccaagcctgaagaaaaatctgaaaaaacatctgaagaggagaaaaagaagcctgtg
gacacaaaaataaccagtcgaactccaagagatgaaagtccaaaagatctgaaagaacaa
cagcttcggggagttgaaaagactgcaacacccaaaaaagaggatgagaaagctcaggag
aaagaaccagctgttccacccaagaagcccagtccaccaggaaagaaagacatgatccag
caggaagaaggagagaaagagcttccaccaaaacaaacagaagccgtgaaaaaaggtgtt
gaactcaaaaagactccatcgcctagagttggtaaagacaaggtagaagaagagaaggcc
ctcaaacctattaagcagctcaagaaggttgagctcaaaaagacaccatcaccaaaagct
gaaccaaagcctaaggaaatggaacaagtccccattgaaaagaagccaagtgctgaaaaa
gtcaagaggattcccaaaatggtttcacccaaagattctattgaagctgtaacactcaaa
aaggtccctaagaagccatcaccacaggtggtttcagaaccagagaagcctggtaaaggg
agggtccccctggtgaaggaggtttctcctggagccgtgcagatgaagaaggtgcccacc
cagccagaggaggaggttttcgaagaggagggagaagaaatggagggtgaggaagatgag
gaggcctggggctgggagcttgttcctcaagaagactgggaagatgaaggggttgatggg
gcactggagactccaggcatgcccggtggtaaacgagatggaaaaccatcagaggaggca
ccaaaaggcagaggccgaggatttggggcaagacaaaccccatcacctggcgatggtggc
aggggccggggcctgaggcctggtggaaagggcccatcgcctccagaggatcccttcgga
ggattcaagctaaaagccgtcccactgaagttcatcaagaagcttcaggacatcgtgctg
aaggaagccgagtctattggctcggctgctgtgtttgattgtcaggtctcaccttctacc
gccatcacttcatggatgaaagatggcagcaacctgcgtgagggccccaagcacaagttc
acttctgatggcaaggatcgcaagttgaacattattgatgtccagctgtccgacactggt
gaatacacctgtgtggccaagaacgctggcaaggaagtaacatgcacagccaagctcatt
gttgaagaactgcctgtgaaatggctgaaggagctggaaccagagacatcatgtatgaag
ggtcagcctatgtacctgacctgtgagctgaacaaggagagagatgtgatctggaagcgt
aacggcgcaatcctgaagaaacaggctggaaaagtggccattaatgtcattggtatgcag
cacgctgtgaccattcagaactccactgatgaagattcgggcgactacacgtgtgaggta
gacggacaggaggaagtcaagactacaaccaacgtcaaagtgattgaaatcatcaaagac
tggctggtgaagcccctgagagaccagcatgtgaaaccaaaggccaaggccacattcaaa
tgtgagctcttcaaggacactcccaactggaagtggttcaaaggagacaacgagctcact
ccttcagacaaggtggagatcaacaaagatggaaaggacatgacactgaccattaagaac
tgtcagcccgaagacgtggcagagtacaccatcgaggtggaggatcgcagatactcagcg
aaactgacacttggagagcgtgaggccgagatcctgaagcctctcgccagcgtggaggtg
gttgagaaggaagaagccaactttgacactgaaatatctgaggatgatgtggctggtgaa
tggaagctgagaggccaggtgttgaccagatctccgacctgcgacattaaagctgaggga
aagaaacgtttcctcacgttgaaaaacgtgcagctggatcaggctggtgaagtgtcgtac
caggccctgaacgccaacaccagcgccatgctcaccgtcaaagagggcgaccccatcttc
gtggtgaagctgcaggactacaccgccacagagaaggacgaggtgaccctggactgtgaa
ctgagcaaagatgtccccgtcgtctggtaccacgaagagacggagatcatcgcctccaag
atggtggtcatgaggtgcgagggcacacgcaggtctttggtcctgaagaaggtggagcag
agcgataaagggaaatacgtatgtgactgtggaacagacaagacctcagccaacatcaat
attgaagctcgtgacatcaaggtggttcggccgatttacggcgtggagctgtttgatgga
gagacggctcgtttcgaggtggagatctcggaggacgacgtccgcggccagtggaagctg
aacggagaaactctcagtccttcctctgatgttgacatcattgaggagggagcgaagcac
acactgatcctgtacaactgcaaagtgtccatgaccggtgaggtggcattcgccgccgct
aacgccaaatgttctgctaacctgaaggtcaaagagcttcctctgaacttcctcactccg
ctgagcgacgttcaggtgtacgagaaggacgaagcaaggttcgagctggaggtgtccaga
gctccgaagacgttccgctggctgaagggttcgcaggagctgcagagcgacgacaagtac
gagatgatccaggaaggaaacatgtacgttctgatgatccgctcggccgcctacgacgac
gaggccaagtacatgtttgaggcagaggacaagaggacgactggcaaactggtcattcag
ggtattcgtttggagtttgtcaaaccaattaaggacgtgacggtgaaggagcgggaaaca
gccgaattcagtgttgaactctcccacgacaagatcccggtggtctggtacaaaaacgac
gtccgtctgcacccgagcaaggtggtgcacatgtcggatcatggaaagatccacacgctg
gccttcaaggaggtcaccatcgacgacacctccatgatcagagtggaggccatggacaag
actgtgaccgccatgctcaacgtcatcgagggcgacctgtatttcaccaccaagctgcac
aactacacggccgtggagaaagacgaggtgaagctggtctgtgagctgagcaaggccgtc
gccgacgtcaagtggttcaaggacgggaaggagatcactccctccaagaacatcgccatc
agcaccgacggcaagaagcgcatcctgatggtcaggaaggcggagaaggccaacatcggc
gcatacacctgcgactgtggctcagataaaaccacagccaacctcaacattgaagagcgc
gacatcaaggtggtccgtcccctgtacagtgtggaggtcacagagacagagacagccaag
tttgagacagagatttcagaggaggacgtccatggaaactggaaactgaagggagaagcc
ctgcaccagtctgctgacgttgagattaaggaggaaggaaccaaacacatgctgatcctc
tataacgtccggatggacatggcaggaggcgtcgacttctcagccgccaacgccaagtcc
aatgctcagctcagagtgaaagctcggtccatcggcctgatgcgtcctctgaaggacgtg
acggtgacggctggagagacagcgaccttcgagtgcgagctgtcgtacgaaggcatcgcg
gtggagtggttcctgggaggacagaagatggaggccagtgaccgggtaaagactcgtgtg
gcgggtcgggttcacgctctgaccgtcagagatgtgaaactgtcggaggctggtgaggtc
aaactgaccgctaaagacttccagactcaggctcagctcattgtcagagagccgccggtg
gagttcacaaagccgctggaggaccagacggtggaggaggaggccaccgccacgctggag
tgtgaagtttccagagagaacgcagaggtacgatggttcagagaaggacaggagatcaga
aagaccaagaagtacgacttgattgtcgacggacgcaagagagcgctggtcatccacggc
tgctctccggaagacgccaagatgtacacatgcgacgccaaagagttcaagacgtcctgt
ttcctggaggttacacctcctcatgtggagattacaaagcctttgcaggatgtggaggtc
agagagaaggaatctgccaagtttgaatgtgaagtgtcccgcgagtccgccaaggtgcgt
tggttcaaggatggaagcgagatcaggagaggaaagaagtacgagatcacggctaaggga
gtccagaggatcctcatcgtccacaagtcagtgtttgacgatgaggcagagtacgaatgt
gacgccagaacctccaagacatccggcatgctcacggtcatcgaggaggcagccaggttc
accaagaacctgtccaacgtggagggaacggagacggacagcgtgaagatgatctgcgag
gtgtcgaaggcaaacgctgatgtcatctggtacaaaggagatgaggagctgccggagggc
ggccgctacgaccagatcatggacggacgcaagaggatcctgatcatccaggacctgagg
atggaggacgccggagagtacaactgcaggctgagtcccaccgtcaagacgtctgccacg
ctgaaactcaacgaactggcggctgagttcatcgcccgtcctcagaaccaggaggtggtg
gagggcgagaaagctgagttcgcctgctccgtctccaaggaaacctatgaggtgaaatgg
ttcagaggtgacaaggaagtcgaagccggggacaagtacacaatcatcattgaaggaaag
agaagggctcttattgtgaaaaactgtgagctgaaggatgaaggaggctacgttgctcac
atcggcagcgttaaagcctcagctgatctgtgtgtgattgaaaaactgaggatcatcacg
ccgatcaaagatacggaggtgaaggagggaagcgagatcgtgttcaattgcgagacgaac
acagagggagcaaaggccaagtggctgaagaacgaggagaccatattcgagagcagcaag
tacatgatggctcagagggacaacgtcttctccctgaggatcagagacgcccagaaggca
gacgaagctagctacaccatcaacctgaccaatcacagaggagagcatgcaaagagcgct
gccagcgctaaagtcgcagaggagaagctgaagttcctggagcccatcgaggacattgag
actcaggagaagaagaccatcagtttcatctgcaaggtgaacaggcccgaggtaacagtg
aggtggatgaaggccggccaggaggtgacgctcaataaacgcatcgtctacagagctgac
ggactcaaacacaccctgaccatcaaggactgcgtcatggatgacgagggcgagtacacc
gctgtggtcggtgatgacaagtgtgcggccgagctgatcatcagcgaggcgccaactgac
ttcgccacacagctcaaagaccagaccatcaccgagttcgaggacgccgagttcacctgc
aagctgagcaaggagaaggctgtcgtcaagtggtacaggaatggacgcgagatcagagaa
ggacccagatatcacatggaaaaagaaggcaagatatgcagactgatcatcaaggtgtgc
agacctgatgatgaaagtgaatacgcctgtggtgtagatgagaggaggacaagagcaagg
ctctttgttgaagagacccccgtggagatcgtaagacctcctcaggacgcatttgaacct
ccaggctcggacatcgtgtttgaggtggagctcaacaaggacagagtggaggtgaagtgg
atgaggaacaacatgatcattgtccagggagacaaataccagatgattagtgagggtaaa
gtccacagactgcaggtctgtgagatcagaccccgagaccagggagagtacaggattgtg
gctaaagacaaggacgcccgtgccaagctggaactggcagctgttcccaagatcaaaacc
accgaccagaatctaatgacagatgccggtaaacccttcgtcatgactgtgccctatgat
gcttaccctcgtgccgatgccgggtggttcttcgagggcaccagtctgcccgtccagaac
atcgacacctctgctgacaagaccgagtaccgccttaaaagccccagcaaggaggaccag
ggccggtacaaagtggtcatcaagaacaagcatggcgaaggagaagcattcatcaacctg
gacgtgattgatgtccctggacccgtcaagaacctgagagtggtcgacacagctgatggt
gaggtcagtttggcctgggaggagccagagagtgatggtggaagcaagattattgcctac
gttgtggaaagacgtgacgtgaagcgtaagacctggactctggcaacagaccgtgctgat
gtcccagagtactgcgtcagcggcctgcacaaggactccatgtacctgttcagagtctgt
gcccgaaacagggttggcagcggacccactgttgccacggaggacgcagtccaggccaag
aacaagtttgatgttcctgatgctccagaaaatgttgcagtagccaatgtcaacaagttt
ggtgccactgtcacctgggagcctcccaagttcgatggtggctcggagatcaccgcctat
gtgatcgaactccgcgacaggacctctgtgaagtgggaggcggctctggtctgtggcgcc
aatgaccgctcggccgcgcttaatgacgtggtggagaacaaggaatacatcttcagagtc
agagctgagaacaaggctggcatcggcaggcccagcgccgccacaaaccctgtcaagatc
atggatcccatcgagaggccaagcccgccactgaacctgaacttcagtgaccaaatcaag
tcggcagtcacactgacctgggagacgcccaccagcaatggtggcagcatgatcaccggc
tacatcattgagaaatgtgacgaaggcagtgacaagtggctccgctgcaacgccagactg
tgccaagacctctcctaccgggtgtctggtttgaaacctggtcagaagtacctctacaga
gtttgtgcagagaacgctgctggcgtgtctgatccagctgagcaactcggaccgctggtc
gccgacgaccctcatgtcggcccgacctttgacctgagtgcctttaggaatggtctggag
gtgatcgtccctcatcctctcaccatcagagtcccgatcactggatacccgacccccgtt
gccaagtggacctttggagagaaggagctgaccactgcggacgagcgtgtctccatggtg
acgaagcccacgtacacagagctgacggtcacaccgagcgtccgtcctgacaaaggcacc
tactcccttcagctggagaacgacgtctcttctgtctctggagagattgaggtcaacgtc
atcgcatgccccagtgctcccaaggactttaaggtggctgaggtgacccggcaccatgtc
cacatgatgtgggaggctccggagcacgatggaggaagtccagtcacccactaccagatc
gagaagagagaagtgtctcgcaagacctgggccaaggttgctactggcatcctggacctg
gagcacactgtgacagatgtcattgaaggaaaggaatatctgttcagtgtcaccgcctgc
aacaagtgtggacctggagagccggcatacatcgacgagcctgttaatgtctcctctcct
gccactgtacctgatcctcccgagaacctgaagtggcgcgataagagtgccaagaccatc
ttcctgtcctgggaacctccaaagtatgacggaggtgccccgatcaaaggctacgtggtg
gacaaatgtcagcgtggtactgacaagtgggaaccctgcagcgaccccatccctgaactg
aagttccaggtcactggcctgattgagggtcagtggtacgcctacagagtcagagctgtc
aacaagctgggagccagccgaccctgcagggccaccgacgagatccaggctgtggatgct
aaagagcctccagagatccagctggatgtgaagttgctggccggtctgactgccagggcc
ggtaccaagatcgagcttccggccgatgtcaaaggaaagcccgatccccgggtgaagtgg
accaaggcggacctggtcctgcgggctgacaaccgcatcactatcgacacagagccagga
cattccaagctttccatcgctgacaccaccagaggggacactgccacctacatcattgag
gccgttaacacttgtggacgcgccactgccactatcgatgtcaacatccttgataaacct
ggtcctccagctgccttcgatatctctgagatcaccaatgagtcatgtgtcatggcctgg
aaccctcccagggacgacggcggctcacccatcactaactatattgtggagtgccgtcag
ttggacaaagaggagtgggtgaagctgtctgccacggtgaaacacaccaccttcaaagcg
tgcaagctcacagccatgaaggagtacgtcttcaggatcagcgctgagaaccagtacggc
atcggtgcacctgcagagcatgtgccgatcattgcaaagtattcctttgatcctcctgga
cctccaaccagagttactccctctgacatcgccaaggatgccgtgactctgacctggttc
gagccagacgaggacggcggcagtcccatcactggatactgggttgagaagtttgatcca
gagagcgacaagtggatcagatgcaataaactgcccatcaaggacacaaccttcagggtg
aagggactccccaccaagaagaagtaccgcttccgtgttctggctgagaatctggctggt
cctggaaaaccaagcgtagagactgatccagtcctcatcaaagatcccattgatcctcca
tgggctcctggtaaacctgtcataagggacattggcaagaccacagccctggtggcatgg
acccggccagagcacgacggtggagctaagattgaaggctacatcattgagttccaaaag
actggaagcgaggaatggatccggattgctgaggacattcctctgaccgagcaccagctg
catggtctgatggagaagcaggagtactcattcagggtcaaggccgtcaacaaagccgga
gagagcgaaccaagtgagcccagcgaccctgtggtctgcaaggagagactttaccctccc
tcccctcctcagtggctggacgtaaccaacatcaccaagatcaacgctgacctgaagtgg
caggctcccagcagtgatggaggctcacccatcaccaactatgtggtggagaagagggac
gtgaggcgaaaggcctggcaggcagttgacaccaccgtcaaggacctcaagtacaccgtg
agtcctctcaacgaagggtcgctgtacgtgttccgtgttgccgctgagaacgccgttggg
acgagtgaattctgtgaattggaggatgctgtgctcgccaaggacactttcacaactcct
ggacctccttatgccctgacggtggtggaggtcaccaagagacacgtagagctgaaatgg
gaagctcccaagagcaatggtggaagaccgataaccaagtacgtgattgagaagaaagag
aagctgggaacacgttggctgaagtgctgcaagactccagacaaacagactcagtttaag
gtgacagatgtggatgaagggtcagaggttcagttccaggtcagagctgagaacgaggct
ggagtcggtgatccaagtgaaccaactgagatcctcaccatcgaggatgcaaccagtgct
ccctctcctcctcttgaagtggccatccctgacgccagccgagagcacatcaacgtcacc
tggaagcctccagccaaggacggtggctgcccgattaccggctaccatgttgaggtggca
gaggcccgcccagagctgaagtggctcagggtcaacaacagacccatcaaggaactcaag
ttcaggattgatgacggaatcaaaccagagaagaagtacgtcatcagagttcgtgccatc
aactctgttggtgtcagcgatccctccgagatctctgacaaggtcttcaccaaggatccc
gactgtgctccaactatggatttggaggcacaagacgtggttgtggttgagggcgagaag
ctgcacctgaacatcccatatagggcgatcccgacgcccaagatggtgtggcagaaggac
acagtggagtgtaaggccgatgaccggctctccatgacagtggagatgaacagcgcgcac
ctggagctgctcaagtgcacacgtgctgatgccggtgcctatgccatcaccctggagaac
agtctgggaactgccactggaactgtcaatgtcaaagtcatcggactccccggtcagtgt
aaagacatcacctccagcgacgtcaccaagaactcttgcaagatcagctgggaagcccca
gaggatgacggcggcacctccattgtcagctacactctggagcgtcgtgaggcatccaag
aagacctacatgcctgtcatgtccggagagaacgtcctgacttacactgtcaaagaactg
ttcatcaattgtgagtactacttcagagtgaaggctgtcaacaaggttggagctggagaa
tatctggagctacgcaaccctgtcatcacagaggaaatcaaacagaaaccagacccacct
atccaggtggaggctcacgacccgacgtccaagtccatcactgtcacatggaaggctccg
gactatgatggcggctgtcccatccagggctatattgtggagaagattgaaaaggacggt
gaccgctatgagagggttaccccaagcctggttcctggtttctcctacgtggtaacaggc
ctgaaggaggacatggagtaccagttcagggtccgcgctgagaatgccgctggagtcagt
gagccgtcacgtagcacaccacttaccaaggctgcagaccccgtcgaaaaaccaaaggtc
acccttcatgcccgtgtgcagtctggtgtctgcattaagaagggcgaggagatccgcatc
gatgccttcatctctgggtctccgtaccccaaagtcacctggctgaagaacgatgaggat
gtcaccaaagagccgaccaaaaagattgttcctttggtcaagaagaagaagtccaaggcc
aaggttccagaaccagaggaggagtttgtgactccactgcgtgagcgtctgggtctggat
cagactcagaagggccgatctgcactgatgatacgcgacgcagtcagaccagaccatgga
aacttcatcatcatggtggagaacactcacggtgttgccaccgcctcctgcaatgtcaac
gtccttgacaaacccggtgctccaatcaacttcaccttcgatgagatcaggaacacatca
gttatctgtaactgggaacctcctgaggatgatggtggcagcgagatcctgaactacatc
ctggagaagaaggacaacagaaacgatgagatcggctggatcaccatcacctccaccctg
aagggaaccagctgccccgtcaccaaactcatcgaggggaaggagtacatcttcagagtc
accgctgagaacaagtttggctgcgggccaccatgtatctccgagcccctggttgccaag
aaccagttcaatcctcctgatgctcccaacactcccagagtccacgaggtgacggcgagc
accgtccacatctcctggcacgagccgaaggacaatggcagcccgatcctgggctactgg
atcgagaggaaggaggtgaacagcaaacactggacccgagtgaaccgggccctcctcaac
tctctggatgtgaaggtcaccggcttgatggagggactcacctacatcttcagagtgtgt
gccgagaacctggccgggcccgggcccttcagtgagcctaccgagcgcattatcaccatg
gacgccatactgcctcctggcccccccactccatggatcgtggatactgggaaggactca
gtcattgtggcctggaagccaccactgtacaacggtggaggagacatcttgggataccac
gttgagaaggttttggctggagagaaggactggactcggagcacagagttcaggtgcaaa
gagctgacatacactgtgacaggcctggccgagggagcagattattatatccgtgtcatt
gccgtcaacgatgccggacccggagctcctggagttactgaacccgtcactgttaaagag
cctcaagaacctcctgctgtggactttgacgactctgtgaagaagggtgtcatgatcaag
gcgggcgagtctttgagacttcccgctgtggtgactggccgaccccagccggaggtcaag
tgggccaaagatgaggccgatatcgacaaagagaggatgatcgttgagacagtgggcaag
aacagcacactgttcatcaagaaggccgtaagggcagatcacggaaagtacaagatctct
ggcaccaacagcagtgggaccaagaccgctgagaccagagtggacgttatggacgtacct
ggaccagtggttgacctgaagacagtcgtggtgacaaagaagaacatcactctcacctgg
tccgaccccttggacaacggcggcagcgacattattggctacgaggtgctgaggaaggat
gccaagatgaaactcttccgccagcccattgagacggcgtcctgtaagtgtgacgtccag
ggtctgctggctggtgaggaatacgactttagggtcattgcaaggaacaaatacggtgat
ggagctccagctgacctgggtcccatcttggcagaggatcccaaaggtactccatctgcc
cctgagaagttgcactacactgatagaagtaagaccactatcactctggcctggcagcca
cctcgcactgatggcggcagccccatcagagggtactacgtggagaagatgaggtctgat
agcactgagtttgacgtggccaaccgcaagatcttcactgagtgctgtggaacgattgag
aacctgtcagagaaccaggagtaccagttccgtgtcaaagctgtgaacgaggtcggggac
ggagatccatccaagccaatcacagccaagatccaggatgatgaaattgctcctgttatc
acgatcctgaagttcttcaagacgaatgccatcatcgtgaggaaagggtcagccatcgac
atcccagcggaggtgaaaggacttcctctgccaacgatccaatggatgaaggacgacgtg
gtcattgagaagcctgatgaggagaagatgaccatggagactgaggaggttaaccggaca
actctgaagacaaagatcgccatcccagaaaccatcaggcaggacaagggcaactacaag
ctggtggctgaaaactgctatggcaaagctcagcatgtcatcacagttgagatccttgac
cgtcctcttcctccgaggaacatcgtggtctcggacattaaggcagactcatgctacctg
acctgggacgccccagaggacaacggaggcagcgagatcaccaactacatcgtggagcgc
agagatgccagcaagaagaagtccgactttgatgctctcactattaatctcatcgacagg
agatatggagtctacaaactggacttgaacggttcctaccagttcaggatcaaagctgag
aacaagtacggcgtcagcgacggctgtgattcagagaaagtccagctgagggatccattc
ggcctccctggaccaccacgtaaccccaaaatcattggcgccacagcgaccaccatgact
ctgacctgggaacctcctctggaaaatggtggttccaccatccagggatactggctggag
aagagggagcgcggcgccgtgtactggggtcgtgtcaaccgagctccagtcaccaaacca
gcagtgaagggcctgcagtacactgtgctcagactcattgaaggaacagagtaccagttc
aggattgcagcctgcaatgccgcaggggttggaccacccagcgaggccactgaatgccgt
ttcactgtggatccatgcaaccctcccagctcacctggatcccccgaggttaaagacaag
accaagagcagcatcactctcagctggagtccccccgacagagatggtggcagccccatc
aagggttacattattgaggtccacgaggagggctctcctgactggaggagggttaatccc
actgacaagctccacccatccaccgaaatcaccgtccctgacctgaaggagggcaaaaag
tgcaagttcaggatctacgctgtgaacgccgctggcaactcagagcccgccaggacgtcg
gacatcctgattcaggacatcctcatcgagccagctgttaccctggacataagcgctcac
gacctgctgaactgcagagcgggaacacccatcaggattcccgccaccatcaccggacga
cccgttccgaaagtcacctggacctttgacggaactgcagagaccgagaagaagaacgag
cttcacacactgcctgtcgactcagagatccactccacagacacaacctcggtggttgtg
attccagagagcaaaatgaaccacagcggccggtacgtcatcaacgcagagagccccgcg
ggacacaaggtggtcaaagtcagagtcaacgtgcttgacctgcctggacctcctagagac
gtgaaggtgagtgatgtgaccaggggaacctgcagactcacctggaaagccccagagtct
gacggcggtgacagggtgaagagctacttcatcgagaagaagacggtggggggcaaagcc
tggaccaaggtgaacacagcctgtgcttctcagtctctggtggttccagatctgatcggc
ggtcaggagtacctgttccgtatccgcgctgagaaccgcttcgggtttggcccctttgtt
gagaccacagagagcgccagagccagagatcccatccatccccccgatcctcccacgagg
ctgaagatccagaacgtgaggaagggcaccgtgactctgacgtggaaggctccaaagaac
gatggtggttcacctgtcacccactacagtgttgatctgctctgctgggctgccagcggc
gagaaggagtcctggaggaggtgcaacaggagagatgtggacaccactactttcaaagtg
gaggatctgacggagggagacgagtatgaattcagagtagtggcgtggaatgaggctgga
cacagccgaccttcatccaccgccggacccatcctcatccaggaccagacctgtgctcca
tctattgagctgaaggagttcatggaggtcgagcagggcagtgacatcagcatcgtggcc
aagatccgtggctgtccgttccccacgctcacctggtacaaagccccgccccacaagtct
gacaacaaagtggaggttcagtatgacgagcacatcaacaagatcgtatcggacgacagc
tgcacgctgctcatccagcagggcaaacgtcccgacactggcctgtacacgctggtggcc
tccaacagcattggcaaggcctccaaggagatgaggctcaatgtgctgggccggcccggt
cctccgtctgctcccattaagtttgaggagatcggggccgagaagatcacgctctcctgg
ctgccaccgaaggacgacgggggctccaaagtcacaaactacgtcatctggaggcgggtg
gccaacaggaagacatgggtgcctgtcaccaatgagcccaaagagcggatctggacagtg
gagaacctgatggagggacacgagtacgtgttccgcataatggcccagaacaagtacgga
gttggagagccgctggacagcgaacccgaggtcgcccgaaaccgctacactgtccccggt
cagtgcgagaagccgacagtcaccaatgtcaccatggactccatgacagttaactgggag
gagcccgaggacgacggtggcacgccgatcaccggctactggctggagcgtaaggagaca
acgggcaaacgctggacccgtgtctcccgcgaccccatccgtcccatgggcatgggcgag
tcgtttgtggtgagcggactcattgaaggctcccagtacctgttcagagtctccgccatc
aacgcagcgggacctggacttcccagcccccccacggaccctatctttgcaagagacccc
atctctccgccctctcctccaacacccaaggtttctgattggacaaggtccacagtggac
ctggagtggatccctcctctgaaggatggaggctccaagatcatgggctactgggtggaa
tacaaggaggaaggaacagaagcctgggtcaaggctaaggagactgaaatccgtggcacc
cggttcgtgatcactggtctgaagaccggcggtcagtacaggttcagggtaatcgccttc
aatgctgccggtaacagcgagccaggcgaagtcccagaggtgctcgaggtcaacgacaga
accattgctcctgaggtcgacctggatgcctcagtgaaggagaggatggtggtccatgcc
ggtggtgtgatccgcatcattgcctatgtgtcaggccagccgtccccagaggttacctgg
agcagagatggagctgcactgcctcctgaggctcaggtggagacgacagccatcagctca
tctctggttatcaaaccctgtgccaggaaacaccttggcgtctacacactgactgccaaa
aacgctggaggggagaagaagaagaacatcacagtggaagttctggacgtccctggacct
gttggtatccccgtcaccgcagagaacctgagcactgattcctgcaagctcaactggttc
ttcccagagaatgacggtggctctcccatcagtaactacatcgttgagaagcgagaggcc
gagcgtaaggcctggacttcagtctccttcaccgccagcagacagaacgctatagttcac
ggcctcaccaccggaaagtcctacttcttcagagtggctgctgagaacgcaatcggcctt
ggacccttcatggaaaccgcctgcgaacttttggtcaaagagcccatcagtgtgccagac
cgccctgaggagctggaggtcaccaaggtcaccaaggatttgatcagcgtcacctggaag
gcacccaagtatgacggcggctcagagatcaccatgtatatcctggaggcacgtatgatt
ggcaaagacaagttcaccagactgacaaaggagaagctgatggacaggaagtacacctat
gacggtctgagggagggcgacacctacgagttcagggtcatcgccgtcaatgaggtcgga
cccagtaaaccatcattttgcaccaaaccaatcacctgcaaggacgaactggagccacca
accattgaactggacttccgggataagatcatcatccgtgtgagtgagagctgcctcctg
cagggccgctacaccggcaaaccttctccgtccatcgtgtggtacagagacgacaacgag
ctgaaggctgacaaacacattatgttcaagaacacgctgaccaccatgtcactgggcctg
atgaaggcagagcgcaaacacagcggcagatacatggtggtggtggagaacagcactgga
tccaggaagggactctgcaacgtcactgttgtcgaccgtccaactccccctgttggccca
gtcgtatttgaagaggtgcacagggagtacatggtcatctcctggaagcctcctctggac
agtggcggcgtggacgtctccaactatatcattgagaagagagacaccaacagagacatc
tggaccacagtgacatctgccacaaccaagaccacatgcaagatccccaagctgacagag
ggcagggagtacatcctgaggatctccgctgagaacatgtatggcatcagcgacccactg
gaatctgaggagatgagagccaaagatctgttcagagtccctgaggcccctgatatgccg
acggtcagggaagtgtatgccaccaacgctctggtgctatggaaccgccctcgcgatggt
gggaagccgattaccaactacatccttgagaagaaggagcccacagccaagaggtggtcc
agagccacaagagacccactgtacccggccactcaataccgagtccaggaccttgtggag
ggctgcgagtacgagttcagggtgatggctgagaatgagctgggtactggagaccccagc
gtcccctccaaacccattcttgcaaaagatcctattgtgtgccccagccctccagtcacc
cctgaggcctacgataagaccaaggacactgtcagcctgaagtggcagatgccccgccat
gatggcaagggccggatctttggttacatcgttgagtaccagaagcctggtgccgtggag
tgggttcaggccaacgagactccagagcagtgccctgatctccactatgtggtgacgggc
ctgaccgatggacaggagtatacattcaggatcttcactgtcaacgctgccggcagatct
gaccctgcctatgtcaaacagtccatcaaagtccacgacagactggaggaaccagagttg
ctgctggacgctaacatggcacgtgaccacctggcaatggtgggagctgacatcaccctg
agtgccacgattaagggtgttccgacacccacagttagctggaaaaagaatgatggagac
gttccatctcacatcactgttgccgtcactggcaccggcagcaaagtcttcattcccaag
tgtgttcgcacggactccggcaacttcacaatcactgcggagaatgctgctggaaagaaa
tctgcaactgttgctgtgcttgtgctgaataagccttctcctcccagagacctggtggtc
tccgaagtgaccagcgagtctgcctacctgacatggaaagctcccgaggacaatggtggt
gctgtcatctcccactatgttgtacataagaaggacgtggctgcagagcagtgggttcct
gtcgctcctgcaaacaagaagctgagtctgatggccatgtacctgatggaaggaatccag
tacctgttcagggtggctgctgagaaccagtttggcagaagtgactttgtgatgaccaag
acacccatcaaggcaattgatcctctctatcctcctggcccaccaaagaacctgcaccac
actgatgcagacaagacagaggtgtggttggcatggcagtggcctgaccgcactggtgga
agtgaaatcactggcttcattgtggagcaccaggaagaaggccagactgactgggtcacc
ttcaagaccgtgagtaataaccacgcccatgtcaccggtctggaggagggcaagacttac
cgcttcagggtgaaggctcagaacgccattggtgtgagccgtccagacactagtgtcccc
atcacctgccaggagaagacattgccaccaactattgaagttgatgtgaagcttatagag
ggtcttgttgtcaaagctggcagcaatattgtccttcctgcaaagatgacaggcataccc
attcccactgctaagtggatgacagatggcaacgagattgcatcagaaggccactatcac
attgagtctgctggatcctcaactattctcagtatccctgagtgcaagagaggagacact
ggagagtacatcctcactgtgtctaatcctgcaggtagcaagactgtcgccctgcatgtc
accgttctggatcttccaggtccacccatcggacccatcaatatcttggaggtcactcca
gattacatgatgatccaatggagggcacccaaagatgatggtggcacgcccatcaccaac
tatgtggtggaaaagaaggatgtgaagaagccatgggagccctggtctgttgttagctcc
agtggcaccagcaccaaggctaaggtgtccaggctggagaagggccgtgagtatattgtc
cgtgtccgagcagagaacaagattggcattggcgctgggcttgagagtcctcccactgtt
gccaagcacatgttcaaccctcctggtccaccaggcctgccagagtgctctgatatcaca
gaaaatgctgtgacagtacaatggagcctgcctgaatacgatggaggaagccccatcagc
ggctatgtgattgaacgcagagaaatgacagggaagtggatccgtgtcaacaaaactcct
gtgctggacctcagatacagagtctcaggcctatttgaaggcaacacctatgagttcaga
gtatttgctgagaacattgctggtatcagtgagccttctcccacctccgaccccatcaag
gccactcgcgctatcactaaacctggaccccctggtaatcctaaactgagggactggagc
aaatcctatgctgacatctgctggacaaagcctacaagagatggtggcagtcccattctt
ggctatgtggttgaggctcagaagacaggaactgcccaatgggacagaatcaacaaggac
ctcatcaagatgtgtgcctacagagtgccaggcctcattgaaggaatggagtacaaaatt
cgtattagggccaccaacaaggttggagacagtgaacccagagaactgccacagaccatc
ttggcaaaggacatcctggtgcctcctgaagttgttgttgacgtggcatgccgcgactct
ctaacagtcagggcaggtcagatcatcagtttgatcactagggtgaaaggcagaccagat
ccagagataacatggaccaaggatgccagagctttgtccagggataaacgcactgaaatt
aataacaactaccctctctgtgaattggtaatcaatgaggcagtcaggtcagactatggt
aaatatgcaattattgccaagaacagtagtggacaggcacaggccacaattattgtcaat
gtcttggacacaccaggagcttgtcagaacataaaagtggcctatgtgactaagaactcc
tgcatggtgtcctgggaaaaccctgaggacaatggaggcactgagattactcagtacatt
attgagtcccgtcagcccagccagagaggttggacagtcgtctccaatgactgcaccaag
cgcctgattaaggctcctcttactgagggttgtgagtacttcttccgtgtcagtgcagag
aataagattggtgctggtccacctactgagaccaagacacctgtgctggcagttgatccc
attgagaagcctggtgaacccattgacttccatatttctgagattggcaagaccttctgc
ttcctcaagtggaggaagccagactatgatggtggtagccgtaacctgggttatcatgtt
gagaagaaaccaaaggaggctgaggagtgggagaggctccataagggtgccattaaagag
acttacttcatggctgacaggtgcatcgaaaaccaaatctaccagttcagagttcagact
aagaatgagggaggcgagagcaactgggtgacaacagctgaggtcctggttaaggaactg
cttgtcgagcctgagatcaagattaaactggatggaacccttgtggtcaaggcaggagac
tccattcctattgaagcaacagtgaagggcaaaccccagcctgatgtcaaatggaccaag
gatgagagcacagaggagattaggaaaggccccaggcttcagattgaaactggtgctgac
ttctcaaaactgctgcttaccggcgccaggcgcactgacagtggcaaatatgttatcact
gccatcaatagtgcaggaaccggcactgctcatgccaaggttaatgtactggatagaccc
ggtcccatcagggatctcaaggtgtctggtatcaccaccgacaggtgccatctagcctgg
gaaatcccagaggatgatggcggctgcgatatctacaactacattattgagaaatgcgaa
accaagagaggagtctggtcagtccactccaatgctgtcatcaccaacaaagctaaagtt
actcgccttattgagggtaatgagtatattttcagagttcgtgctgagaataagatgggt
cctggtcctgcagtgcagagtggatccattgttgcaggcacccagttcagtgtacctgat
gctcctgaagcaccagaagtcaccaagattgccaaggaggagatgaccgtgcagtggtca
gagccagagaaaaatggaggcaagccaatcacaggttatcttttggagaagagagaggag
catgccgttagatggtctcctgtcaacaaagatccagtccctggaacgcgtttcacagtt
acaggactcttgcccctccatgactaccagtacagagtcaaggctgtcaatgaaatcggc
attggtaacccaagcaagccatcacgtgccattactgccaaggatgcagttgagcctcct
gcacctcctaccaacttgaaggtcatggacagcaccaaatcaagtgtcaccctgggctgg
accaagcctgtatctgatggtggagctccgctcattggctatgttgtagagatgagagca
cagggctctgccaagaaaggagatgatggttggaagaggtgcaacgtagcagctcagctg
gtcgtgtgcgagttcacggtcacaagtctcgatgagaagcttgcgtatgaattcagagtg
tcggctcaaaaccaggtgggcatgagcctgccctgtgacctggagggtgctgtgatcccc
aaggagattctagaggcaccagagattgacttggatgctagcctgaagcagggactgaca
gtgagagctggctgtcccatcaggctttgtgccaccatcagaggcagaccacctcccaag
gtaacttggaggaggatgggaatcgacaacgtggtcaggaagggaaaggtcgacatcatt
gacaccatgaccttcctggttatccccgacagcacacgtgacgactctggcaaatattgc
ctgactgtccagagccgtgctggagagaaggctgtgtttgtcaatgttcaggttcttgac
actcctggacctgtaatgaatctggaagctaccgacatcaaacagacatctgctatgctg
tcctggagtcctccagataacaatggtggcaaagaagtcactcattacattattgagaag
cgcgagattgaccgcaagacatgggcaaccgtcaaggccgaagtggagaaggataaggtt
cccttcaaaatcagcggtctgatgccagggactgaatactacttcagggtcacagctgtc
aatgagtatggttctggagtacacagagtgacacccacttcctatatggcctctgatcct
gtcagcaagccagatccctgtgaaaagattgaggttctggagatcactaagaacagtgca
acggtcggctgggtgaagcctttaagggatggtggtgccaagatcgacggttatgtgatt
gaatacatagaggtcaaacctcctccagagcccccagcacctgtggaggttccagaagga
gaggaggctccactgccaccacctccacctccagtggtagtggaggaagaggaggagcct
gaaaaggaagtgtggaatgcttacaccacagtgaaaggtttgacaatcagcatcagcggc
ctgaaggagggcaagaggtacaagttcagagtggctgccaagaacatcatgggcatgagc
tcattcactgagacgagggagccaatcgagatcaaggaacaaatgttggaaccaaagatt
gttatgccagagacagtgagcgccagagccggagccaagctcagagtggaggcactggtt
tctggaaaacctgctccaacctgcaagtggatgcgtggtgagaatacagtagtcccatcc
agtcgtctggctgtgcaccagtccggcaacctgtgtgtcctgatcatcaaagatgtgtca
aggactgacagcggagagtacagcctggtggctgagaatagctctgcgaaggtggttcaa
gccctgaagatcatcatcagagacatccctggtcctcctgaaggccctgtggagatcagc
gacatcgactctgatgcctgctccctgtcctggaacaaaccactggaggatggaggcagc
aatatcaccaattacgtagtggagaaatgcgatgtgactagaggtgactgggtgacggcc
gtctcttcctgctcaaagaccaattgcaggcttggaaagcttattcctgggaaggagtat
gtattccgcatccgtgctgagaaccgctttggtgtatcagatcccattcagtctgacagg
atggttgccaagttccccttcgatgttcctagcgagcccctcaactgccacatcaacaaa
accaacaaggactgtatgtttgtggcctgggataagcccgagactgatggcggcagtccc
atcacaggttactatattgagcgtaaggagaggaacagcctgctctgggtgaaggccaat
gacacagttgtccgcactactgagtacccatgcgctggcctcatcgagggcctggaatac
acctttagagtgtccgccatcaaccgtgctggccagggcaaaccaagcaagaagactgac
tttgttactgccagaacacctgttgacactccaggtaaacctgagatcctggatgtaacc
aagaacactgtcactttggtttggacccgtcccaagaatgacggtggaagcaagatcatt
ggctactacgttgaggccatgcgagtgccaggagatcattggatacgctgcaacaccagt
agccagaatgttccaagggaggagtatacagttactggcctggagagagacctgcagtac
cagttcagagtcatcgccaaaactgctgtcaacataagcaaaccctctgagcccacggac
cctatcttggtctgtgctgagaatgttcctccaagagtggagctcaatgccaagatgcag
aagggtataaaggtgaaggctggagccacagtactgctggaagctgaggtattcggtaag
cccatgcccagagtgacctggaagagaggcgacgatagcctgaagtcaggtgaaggccag
gtcatcacccatcagaggcatcacttccagctggaaatgacaggagtcaccaaggagcac
acaggaacctacaccatcctggcggagaatgccagtggctccaagactgctgagatccag
atcaacattctggatgtgcctggtcctcctgcaagtgccaaattccttgaggtgtcagcc
accagtatcaagctgtcctgggagcctcctctgaaggatggtggtgcccccatcaccagt
tatattgtggacaagcgtgagaccagcagagctaactgggccctggtctgcgccaagctc
aagggtgacatccttgagtacaatgtggagaggctgatcgagggtcgcgagtaccagttc
cgaatccgtgctgaaaacatgtggggagttggagaccacctcatcactaaccctgtcatc
gccaaaaacccgttcactgtccctggcccttgtgaggccccggtgatcaccaatgtgacc
aaagaccatatgactgtgagctggaaggagcctgctgatgatggaaagtccacaatcctt
ggttacatgctggaaaagaaagaggccaaggacttgaactggactaagctgaaccggaaa
cctctgacagaaaggacacttgatgttacaggcctcacagagggaactgagtacgagttc
agagtcattgcagtcaatgttgcagggcttggcaaaccgagcgaaccctctgcaggcacc
tacgcacaaaatcccatcactcctcctggcccagttgtgaatccaagtgtgacagacacc
accaacagcaccatcagtctcacctggactgcccccgccaacaatggtggaagccccgtt
attggatacttggtggagtgcaagaggactgacaccgcagactggatccgctgcaacgtc
cccaggaacctgcaggagaccaactatgtcatccagaacctcattcacaaggctgagtac
cagtgtcgcatcactgctgtcaacaaggttggcttcagcgagccagttgaagtacctgga
aaacatattgccaaggacatcattgttcctccagaggcagagctgagcgcagagctaaag
gagggcctggagctgcgtgctggcagcaccatgaggctgcatgccaccatcaagggccgt
cccaatcccaagatcacctgggcaaagatgaacaccaatatcaaggaccgccaaggcatc
atcatcaaatcaaccaacgctgacaccactgtgatggtggaaaatgtcaacagatatgat
gctggcaaatacattctgaacctggagagcctggctggcatgaagatgtacaccatcgtt
gtcaaggttcttgacactcctggaccaccagtcaacctggtcgtgaaggagacatccaaa
gacagtgcctccatctactgggatactcctctgattgatggtggctatgaagtcacccac
tacattgtggagaagcgtgatactgagaggaaagcctggtccatcgtctccaacaactgt
gccaagacagcattcaaggtcccagacctggatgctggaaggtcctactgcttcagagtg
tcggcagttaacaagcttggtgctggagagtgctgcgagacagccgattcagtcagagca
tcagaggagcctgggccagtcatggacttcaagaccctgttggttaccaaggactcttgc
actctaagctggaagaaaccactcaccgacggtggcagccgcatcatctgctacgtgctg
gaggttctcaatggtgaggacaagtacaaggagctaatgaggtccaagaacatgcaatac
agcgccaaggacctggtggagggcaaagagtacaactatagagtcaaggctgtgaatgac
acaggagagagcgctgcaagggaactgacagtggttgccaaggaccagatcattcatcca
acctgtgacttgagggatctgcctgacatgtgctacattgccaaggagggcagcaccgtc
cgtctgaagatcccaatcattggcaaacctacgcccaaggtctcctggaagaagggagac
gatgaagacctgacagatactggccgagtgtgcgcagagtcctctgcagtcaacaccacc
ctcctgatcagagactgccagaggagtgatgcttctaagtacaccatcaccttgaggaac
agcgctggaagcaaagagtccaccatcttcatcagggttgtaggtaaacctggcatcccc
attggacctgttaagttcaaagatgtcactgctgatggtgctacgctgaagtggggtgct
cccaaggatgatgggggctcagagatcaccaactacattttggaaaagagggactccatc
accaacatgtgggtgactgtgtcctcgactgtggagacaaacaccatgagggtaaccggt
ctccatgagggcacagaatacatcttcagagtctgtgcggagaacaagtacggcgttgga
gaaggactcaaatctgaacccatcgtcgctaaacatccattcaatgttcccgacgctcct
cctcctcctcagatcgtgagcatgcgtcatgactcggcatacctggcctggtctgatccc
aggaaaactggaggatctcccatcacaggctaccatgttgagttcaaggagaggaacagt
atgttgtggaagagggcaagcccagctgccttgaggatgaaggaacacaaggtgactggg
ctgactgaaggtctggagtacgagttcagagtcatggcaatcaacctggctggcatcggc
agaccgagcgctcccactgatccacaggtggccctggatcccattgatgcccctggtaaa
cctgatgtggtcagcatcacgaggagcacagtgactctccaatggactgaaccacaattc
gacggtggccacaggctgactggctatattgttgagaggcgcgaccttccatctaagatc
tgggttaaggctaacaatgtgaatgttgtggagcctgcgttcactgtcaccgatctgcag
gagggttgcaaatatgagttcaggatcagggcgaagaatgctgctggtgctctcagccca
ccctccgagcagacagacaccatcatctgcagagatgaatatgctgcaccaaccattatt
attgatgctcaggtgatggagggtctgactgtccgagccggtgataccattgttattact
gccacaagcattttaggcaaacctgcaccaacttcatgctggtcaaagggaggaaagtac
tttaaaccctctgacattgttcaaattgagaccaccgcaacttcctctactctatccatt
aaatatgccggtaggaaggactctggagactataccataactgccagcaaccccttcggt
gtaaaggaggaaactgttaaggtcaaagttctggatgttcccggagctcctgggcccgtt
gaatgcagtggtatctcatctgaaaaagtgactcttacgtggacagcacctactgaggat
ggaggctcgcctatcaaatattacaccatcgagaagagagagaccagccgcctgctctgg
actgtcctggaagagaacgtcatcaactgtcactatgtggccaacaagctcatccagggg
aatgagtacttcttcagagtctctgctgttaaccagtatggtgccagtgagccttctcac
tcggaggcagtcaagatggttgatagatttggtcctcctggtccaccatccaaaccagag
gttgataaagtggatggacattcagtcactgtgaagtggaggagaccagctgaggatgga
ggaagtgatatcattggttactgtgttgagaagaaggagaaaaaggctatgggatgggtc
agggcatccaagaaatccattgctgagctcagctacgaagtcaccggtctcactgagggt
gtggagtatgagttccgtgttcttgctgagaacaaagctggctttggagagccgagtgaa
ccatctatgcctgtcagaacaatagtcgttgcctatgtgcctggacctccagtgaatcca
agagtcacagacacaaccaagaccactgccacactgaactggggaaaacctcttgataat
ggtggacttcaagtaactgggtatgtgattgaacacaagaaagaaggaacagaagaatgg
attaaggatactccttcatctctacttaggatcacagaatttgttgttcctgggctggag
actggtgcaaaataccacttcagaattagtgctgtgaatgctaagggggcaggtgaacct
gctgaaactcaagagctggttgagatcgtggagcgtgcagctgagccagatttggagctg
gatgttgagctgagaagaacccttgtggtcagggcgggctgctccatacgactctttgtg
ccaatcaagggacgtcctacacctacagtcacctggactaaggagggtggtcctgtccca
cgggcagtcattgacaccaccgagtcatttacaatgctgcttattcctgagagttcaagg
attgatgcaggcaaatatgagcttaccctcgaaaattcagctggaaagaaaagtgctgat
atacatgtgagagttctggattcacctggacctccacttaacctgaaacccatcaagatt
gacaaggaaagtattactcttcagtgggagatgcctcttatcgatggtggagccaagatc
acaaactatgtcattgagaagagggaatcaacacgcaaggctttcgctactgccgttaca
aattgtccacatacttcaatcaggattggtgatttgggtgagggttgtgagtactatttc
agagtgtctgccgagaatgagtatggcattggcgaggctgttgaaactacagatccaatt
cgtgcatcccaggcaccaactcctccagagagtattattcctactgatgtcaccaagagc
tctgtgagcctggcttggaccaaacccaagcacgatggtggaagcagaataacaggatac
gtcctggaagcccagaagaagggaactgatcagtgggcccacgtaacaacagtcaaggcc
atggatttcactgtgaaaaatctcaatgagaatgaggagtacattttccgtgtaatggct
gtcaaccattcaggcagaagcgctccacgtgagagcaaacccattgctgttaaggattct
acttcactgcctgagtttgacctgcgtggcgtatgtcagaagattgttattgccaaggca
ggcgatgacatcaaggttgagatcccagttatgggacgtcctagaccaactatctcctgg
cagaaggatggcgcagccctgaagctcacacagagaaccaatgtggagactaccgctgct
actgttgtcctcagcatcaatgaatgcaaccgagccgacagtggcgtctacaccatgaca
ggaaagaacattgttggttctgtgatagataacatcaccgtcaaagtacatgatgtacca
gggccacctaagggacccattaagattgtggagatatctcgtacctattgtgtctttgca
tgggacactcctgagaatgatggaggtgttccaatcaataattacgttgttgagatcaga
gacaccacttcccaaacatggacagagctgtcctccactgtcatccgtaccatgttcaaa
gccatccgattaaacactggatcagagtaccaattcagagtaaaggctaagaacagatat
ggtgttggacctcccatcacctcagcagcagtggtggctgcctatccatttaaagtccct
ggacctcctggcactcctagtgttgttgcatttaccaaggactctataacgattggctgg
aatgagcctgtgtctgatggtggaaatgaagtcattggttatcatgtggaaaggaaagaa
agaagcagtattatatggcacaagatcagtaagggtattgtgaaaggaaacatctttaaa
accactgggcttgaagatggtgttgcctatgagttccgtgtcatggctgaaaacatggct
ggaattggtaagcccagcaaggcctcagaagcaatactggccttggaccctgtagaccca
ccaggccagcctgtgccaatatttgtcaacaagaatgtcatcactattcagtggacaaag
cctgagtatgatggtggcttcaaaatcactggctacacagttgagaagaaagaacttcca
gctggtcgctggatcagagccaacttcaccaacatcattgagacaactttcactgtcagt
gggctgacacaagatgcctcctatgagttccgtgtcatagccagaaactcagcaggtgca
gtaagtgtgccctctgacccctcagacccaattatctgcaaagatgacattatcgagcca
cgcattatggtcgatgccatctttaaggatgttgttctactgaaggcaggagaatctttc
aagcttgatgctgacattgctggtcaaccaacaccatctatggtttggaccaagaatgga
aaggagattgagaacacaatgaaactggatgttaagttcactgaactgacaaccactctc
accaacaaggactctgtcagatccgatggaggagaatttgttttgactgccactaatgtt
ggtggatttgctaagcacatctttaatgttaaagtgctcgacagacctggaccaccagtt
ggacctcttaaggtgtctgatgtcacagctgataactgtgtactgacctgggctccacct
gcagatgatggcggtgccaagattgaaggatatgtggttgagaagcgtgagtcaagcaga
ctggtttggaccaatgtggtttcagacctacagactacacaatataaggtggctaagctg
cttaaaggaaatgaatacatcttcagagttatggcagtaaacaaatatggacttggcgag
tctcttgaatcagaaccaactattgcagataacccatatgttgttccagatcctccagag
aatcctgaggtgacagctatcactaaagattcaatggttcttatgtggcaagcacctaag
agtgatggcggaactcccatcaccaactacaatattgaaaggaaagacagaataggcctg
cgctgggtcaaatgcaacaagagaaaggtcaaagatcttcagttcaaggcagcaggcctt
gttaatggacatgaatatgaatttagagtaatagctgagaatgctgctggagtgagtgca
ccaagtgtctccagtccattctacaaggcaactgatggactgtacaagccagggactcca
tgcaaccccagaatcttggacacaaccaagtcctcaattactgttgcctggaacaaacct
gtgtatgatggtggctctgacatcactggctacattgtagagacatgcatcccatctgaa
aaggaagaagaggaggaatggaccattgtgacacccaaagaaggtctcattgccacctca
ttcaccattattaacctgaaggagaaccaggagtacaagatcaacatctcagctgtcaac
agtgaaggaattggagatgcagcatctgtaccggacaataccaaggcagaggacaggctc
ctcccacctgagatggatttggatgctgagctccgcaaggttgtgagtcttagagcttgc
tgctcacttagactgtttgtgccaatcagaggcagaccagctcctcaggccaaatggacc
aaaggagatggtgagccaattgagagggcaaccattgacagcacaacatcatacacatca
cttgttattgaaaatgtaaacagatttgacagtggaaagtataatcttacaattgaaaac
agctctggctccaggactgttacagtccaagttagggtgcttgatacaccaagtgcccca
cagaatctgaagattactgctgtaacaaatgaagctgtcactctgacttgggatccacca
gtgaatgatggaggagttaagttaagaactatattgttgaaaaacgtgagtcgacaagga
aagcatacgccacggtcaatgctctatgtcatcataccaccttcacaattggccagctcc
tggaaggatgcaattattacttcagagttttggccgagaatgaatatggcattggcttgc
ccattgagactggtgaatcaattaaagtgtctgagaaaccacagccacctggcaaagtca
ctcttaaggatgttaccaaaaacagtgtcaccctctcctgggagaagccagagcatgatg
gtggcagcagagtag

DBGET integrated database retrieval system