KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111657861Help
Entry
111657861         CDS       T06058                                 

Definition
(RefSeq) glutathione peroxidase 1-like
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00480  Glutathione metabolism
slal00590  Arachidonic acid metabolism
slal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    111657861
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    111657861
Enzymes [BR:slal01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     111657861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin NdhM
Motif
Other DBs
NCBI-GeneID: 111657861
NCBI-ProteinID: XP_023265962
Position
Unknown
AA seq 191 aa AA seqDB search
MAANVKRFYDLTAKLLSGEVFSFAALKGKVVLIENVASLUGTTTRDYTQMNDLHSRYSDK
GLVILGVPCNQFGHQENCKNDEILRSLKYVRPGNGFEPKFQLLEKVDVNGKDAHPLFVYL
KEKLPFPSDDTMALITDPKCIIWSPVCRNDVSWNFEKFLVSPDGEPYKRYSRSFLTKDIE
ADIQELLKRVK
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaatgtgaaaaggttttatgatctgacagctaaactgctgtctggagaagtc
ttcagcttcgctgcactgaaggggaaagttgttctcattgagaatgtggcgtctctttga
ggaacaacaaccagggattacactcagatgaacgacctccactctcgttattccgataag
ggactcgttattctgggtgtaccctgcaatcaatttggtcatcaggagaactgcaagaat
gatgaaatcctaagatctctgaagtatgtccgtccagggaatggttttgaaccaaagttc
cagctccttgagaaggtggatgtgaatggaaaggatgcacaccccttgtttgtctatttg
aaggaaaagctgccatttcccagtgatgataccatggctctcataactgatccaaagtgc
atcatttggagtccagtgtgtaggaacgatgtctcctggaactttgagaagttcctggtt
agtcctgatggagagccctacaagcgctacagcagaagtttcctcaccaaagatattgag
gcagatattcaagagctactcaagagagtcaagtaa

DBGET integrated database retrieval system