KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663328Help
Entry
111663328         CDS       T06058                                 

Gene name
iws1
Definition
(RefSeq) protein IWS1 homolog
  KO
K17498  transcription factor SPN1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:slal03021]
    111663328 (iws1)
Transcription machinery [BR:slal03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     111663328 (iws1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 111663328
NCBI-ProteinID: XP_023273255
Position
Unknown
AA seq 701 aa AA seqDB search
MDGEEDDFMSGSRSDDGGGTPVQDEHPASDGEDMRSDRQQSEDEGSNDEDAPHAMETSGA
ASGSDNEGHQGVNSDSEGEAPRHHNDGDKSDSEAEAPRPADSDDDSPVKRRMSGSDNEEE
SLVKHGASENEEGEGSSPVRRRGSSSDMEEGEERHKAAADSDSENEDAKPVASNRSNADS
DSDTETPARRKVAQIDSEEEGKQQEEVERGGGGKWKAVMQSDSEEEEGGRRKAPAGSDGE
QQDEEREQRDDSDDEKPVKRKKAIVSDSEDEDEEKEDKPAVKRSRAVSDDENSDSDGGLI
GPDKSLAAKLRELGSDSGSDDEASKATAGKKDEKALFGSDSDSGDDDEEEKMIADIFGES
GDEEEEEFTGFNQEDLEGAKKEAREKQHQLEEESDSDEGVDRSGQDTSFMSDFDIMLARR
KAMNSRKRRHRDGGTFISDADDVVSAMITKMNEAAEEDRTLNSQKKPALKKLTLLPQVVM
HLKKQDLKETFIDSGVMSAIKEWISPLPDKSLPALRIREELLRILQELPSVSQETLKHSG
IGRAVMFLYKHPKESRSNKDLALKLINEWSRPIFGLTSNYKGMTREERQQRDLDQQMPQR
RRLSSGGQTPRRDLEKQLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNVEVDSSR
GPMKKGLSRVDKQMRRFADIRRLTKTGHAVKISVEGNRMPL
NT seq 2106 nt NT seq  +upstreamnt  +downstreamnt
atggacggagaagaggacgacttcatgtccgggagccgctccgatgacggaggtggcact
ccggttcaggatgaacacccagcgtcagacggtgaggacatgaggagcgacaggcaacaa
tctgaggacgagggcagcaacgatgaggatgccccccacgccatggagaccagcggggca
gccagcggctctgacaacgagggccaccaaggagtcaacagcgactcggagggcgaggcc
cccaggcaccacaacgatggcgacaagagtgactcggaggcagaggctcctcgtcccgct
gacagcgatgacgactctccagtcaaacgcaggatgagcggatcagacaatgaggaggag
tccctggtcaaacatggagcttcagaaaacgaggagggggaaggttcgtcccctgtcaga
cgcaggggcagcagctcggacatggaggagggggaggaacggcacaaagcagccgcagac
agcgactcagagaacgaggatgccaaacctgtggcatccaaccggtccaacgctgacagt
gactctgacacagagacgcctgccagacgcaaggtggcacagatagactctgaagaggag
gggaagcagcaggaggaggttgagcgtggaggaggagggaagtggaaagctgtgatgcag
tctgacagtgaggaggaggaaggaggaaggaggaaagctccagcaggaagtgatggagag
cagcaggatgaagagagggagcagagagacgacagtgatgacgagaagccagtgaagagg
aagaaggccatcgtatcagacagtgaggatgaggatgaggagaaggaggacaaaccagca
gtgaagaggagtcgggcagtgtcagatgatgagaactcagacagtgatggggggttaatt
ggtcctgataagagtctggcagccaaattgagggagctgggctcagacagtgggagcgat
gacgaggcgtcgaaggccacggcggggaagaaggatgagaaggcactgttcggcagtgac
agcgactctggagacgacgatgaggaggagaaaatgattgcagacatctttggagagtct
ggagacgaggaggaggaggagttcacgggtttcaaccaggaggacctggagggggccaag
aaggaggccagggagaagcagcaccagctggaggaggagtctgactctgatgaaggcgtt
gaccgcagtggtcaagacaccagcttcatgtctgacttcgacatcatgctcgctcggaga
aaagccatgaacagcaggaagagaagacaccgcgacggagggacattcatcagcgacgct
gatgatgtggtcagtgccatgatcaccaagatgaacgaagccgcagaggaggatcgaact
ctgaacagtcagaagaaaccagcgctgaagaaactcactctgctgccacaagtcgtgatg
cacctgaagaaacaggacttgaaggagacgtttattgacagcggagtgatgtctgccatt
aaagagtggatcagtcctcttccagataaatcactgcctgctctcagaatcagagaggag
ttgctcaggatccttcaggagctgcccagtgtgagtcaggagactctgaagcacagtggg
atcggccgggccgtcatgttcctgtacaaacatcccaaagaatctcgatccaacaaagac
ctcgctctcaagctcatcaatgagtggtcgcggccgatctttggtttgacgtcgaactac
aaaggaatgacgagagaggagcggcagcagagagacctggaccagcagatgcctcagaga
cggcgactaagttcagggggtcagacgcctcgcagagacctggagaaacagctgactgga
gaggaaaaagctctgcgacccggagaccccgggttctgtgccagggctcgggtcccgatg
ccttccaacaaagactatgttgtacggcccaagtggaacgtagaggttgactccagcaga
ggtccgatgaagaagggtttgtctcgtgttgataaacagatgcgtagatttgctgacatc
cgccgcctaacgaagacgggtcacgctgttaaaatcagtgttgaaggcaaccggatgccg
ctctga

DBGET integrated database retrieval system