KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663437Help
Entry
111663437         CDS       T06058                                 

Gene name
ddx18
Definition
(RefSeq) ATP-dependent RNA helicase DDX18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:slal03041]
    111663437 (ddx18)
   03009 Ribosome biogenesis [BR:slal03009]
    111663437 (ddx18)
Enzymes [BR:slal01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     111663437 (ddx18)
Spliceosome [BR:slal03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    111663437 (ddx18)
Ribosome biogenesis [BR:slal03009]
 Eukaryotic type
  90S particles
   Helicases
    111663437 (ddx18)
  Pre-60S particles
    111663437 (ddx18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 Transferase Nop14 AAA_22 ORC6 Zip
Motif
Other DBs
NCBI-GeneID: 111663437
NCBI-ProteinID: XP_023273401
Position
Unknown
AA seq 638 aa AA seqDB search
MCLSVNSNGLEEDCCEKPAAACKADRKPKKKQKKQNGEPVEGTSTEKTLAQKKKKKKRKL
TDTNESPAEKKTKTVKEDEEEEEEVEEAAVADEDEDATDKLEEGVDDDDDDDEDDEEEET
GEGDSEEEDQPELPSGLTGAFEDTSFASLNGLVSESTLNAVKEMGFEHMTEIQHKSIRPL
LEGRDVLAAARTGSGKTLAFLIPSIELINKLKFMPRNGTGVVILSPTRELAMQTYGVMKE
LMTHHVHTYGLIMGGSNRSAEAQKLANGVNILVATPGRLLDHLQNTPGFMFKNLQCLIID
EADRILEVGFEEELKQIIKLLPKKRQTMLFSATQTRKVEDLARISLKKEPLYVGVDDNKD
NATVDGLEQGYVVCPSEKRFLLLFTFLKKNRKKKLMVFFSSCMSVKFHYELLNYIDLPVM
AIHGKQKQTKRTTTFFQFCNADSGILLCTDVAARGLDIPEVDWIVQYDPPDDPKEYIHRV
GRTARGINGRGHALLILRPEELGFLRFLKQAKVPLSEFEFSWTKISDIQSQLEKLIEKNY
YLHKSAQEAYKSYVRAYDSHSLKQIYSVSTLNLPMVALSFGFKVPPYVDLNVHSSKGVKI
QKRGGGGGFGYQKSKNAHKSKIFKHVNKGRSDRRQFSR
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgtgtttgtcagtaaactcaaacgggctggaagaggactgttgtgagaagccagcagct
gcttgtaaggcagacaggaagcccaagaagaaacagaaaaagcagaatggggaaccagtg
gaagggaccagcacagagaagaccctggctcagaagaagaaaaagaaaaaacggaagctg
actgatacaaatgaatcaccagctgagaagaagaccaaaacggtgaaagaagacgaagaa
gaggaggaagaggtggaggaagcagcagtggcagatgaagatgaagatgctactgacaaa
ctagaggaaggtgtagatgatgatgatgatgatgatgaagatgacgaagaggaggaaact
ggagagggagatagcgaagaggaagatcaacctgaattaccatctggtctaacaggagcg
tttgaggacacgtcgttcgcttctcttaatgggttggtgagtgagagcactctgaatgca
gtgaaggagatgggctttgaacacatgactgagattcagcataaaagtattcgccctctg
ttggaaggaagggacgtgttggcagcagccaggacaggcagtggtaaaaccttggcgttc
ctcatcccgtctatagagctcatcaacaaactcaaattcatgcccaggaatggcactggt
gtggtgattctttcacccacacgtgagttggcaatgcaaacctacggtgtgatgaaggag
ctgatgacacaccatgtgcacacctatggtttgatcatggggggcagcaaccgctcagct
gaggctcaaaaactggccaatggtgtcaacatcctggtggccacccctggccgtctgctg
gaccaccttcagaatacccctgggttcatgttcaagaacctacagtgtctgattattgac
gaggccgaccgtatcttagaggtaggcttcgaggaggagctgaagcagatcatcaaactg
ctgccgaagaagagacagaccatgctgttctcagccactcagactcgtaaggtggaggac
ttggctaggatatccctgaagaaggagcccctctacgtcggggtggatgacaacaaagac
aatgctactgtggatggcctggagcagggttatgtggtgtgtccatcagagaagaggttc
ctgctgctcttcaccttcctgaagaagaaccgtaagaagaagctgatggtcttcttctct
tcttgtatgtctgtgaaattccactatgagctactcaactacattgacctacctgttatg
gccatccatggcaagcagaagcagaccaaacgtaccaccaccttcttccagttctgcaac
gcagactctggcatcctgctgtgtacagatgtggcagctcgaggtctggacattcctgag
gtggactggattgtccagtacgatcctccagatgacccaaaggaatacatccacagagtg
ggcagaacagcccgaggcatcaatggaagaggccacgccctcctcatccttcgaccagag
gagctcggtttcctgcgcttcctcaaacaggccaaggtcccattgagcgagtttgagttt
tcctggactaaaatctctgatattcagtcccagctggagaagctgattgagaagaactat
tacctccacaagtcggctcaggaggcttacaagtcgtatgtacgggcgtacgactcgcac
tcactcaaacagatctacagcgtcagcaccctcaacctcccgatggtggcgctgtcattt
ggcttcaaagttcctccatatgttgatctgaacgtccacagcagtaaaggtgtaaagata
cagaagcgaggcggtggaggtgggtttggataccagaagtccaagaacgcgcataagtcc
aaaatctttaagcacgtgaacaaaggaaggagtgacaggagacagttctcccgctga

DBGET integrated database retrieval system