KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111663657Help
Entry
111663657         CDS       T06058                                 

Definition
(RefSeq) rho-associated protein kinase 1-like
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04270  Vascular smooth muscle contraction
slal04350  TGF-beta signaling pathway
slal04510  Focal adhesion
slal04530  Tight junction
slal04810  Regulation of actin cytoskeleton
slal05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    111663657
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    111663657
   04530 Tight junction
    111663657
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    111663657
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    111663657
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    111663657
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111663657
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:slal03036]
    111663657
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111663657
Protein kinases [BR:slal01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   111663657
Chromosome and associated proteins [BR:slal03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    111663657
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_Binding Filament BST2 DUF2730 Spc7 PRANC DivIC DUF960
Motif
Other DBs
NCBI-GeneID: 111663657
NCBI-ProteinID: XP_023273713
Position
Unknown
AA seq 200 aa AA seqDB search
MRELQDQLEAEQYFSTLYKTQVKELKEEIEERNRQVQEANKKVHELCSERDSLSAQLDLT
VTKAESEQLARALQEEQYFELSQENKKAVTRHKQEIGEKEATIARLEESNKTLTKDVENL
SKEKSDLNEKLHIQDEEYAAQKEEIANTIKATYEKVLNTERTLKTQAVNKLAEIMNRKDM
KLDQKKKGSTADLRKKEKEN
NT seq 601 nt NT seq  +upstreamnt  +downstreamnt
atgagggaacttcaggaccagcttgaggccgaacagtatttttctacgctttacaaaact
caggtcaaggagctaaaagaggagattgaggaaaggaaccggcaggtacaagaggctaat
aaaaaggtgcatgagttgtgcagtgaaagggactccctgtctgcccagcttgatctgacg
gtgaccaaggccgagtcagagcagcttgctcgggcgcttcaggaggaacagtactttgag
ctcagccaggagaacaagaaggcggtgactagacataagcaggagatcggggaaaaggag
gctaccattgcacgacttgaagaatccaataaaactctgaccaaagatgtggagaacctc
agcaaagagaagtctgatttgaatgagaagcttcatattcaggatgaagagtatgcagct
cagaaggaggagattgcaaatacaatcaaggccacctatgagaaggtcctcaacactgag
cgcacactgaagactcaggcggtgaacaagctggcagagatcatgaaccgcaaggacatg
aagctggaccagaagaagaagggcagcactgccgatctccggaagaaggagaaggagaac
c

DBGET integrated database retrieval system