KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664021Help
Entry
111664021         CDS       T06058                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04020  Calcium signaling pathway
slal04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111664021
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111664021
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:slal04030]
    111664021
G protein-coupled receptors [BR:slal04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    111664021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srsx 7TM_GPCR_Srx PIRT DUF5409 Pho86
Motif
Other DBs
NCBI-GeneID: 111664021
NCBI-ProteinID: XP_023274226
Position
Unknown
AA seq 358 aa AA seqDB search
MDNGSLGLLGDANTSLQIELQSCTTVRNQVSRIFLYAFLSVGIACTVVGNFLVVLSIAYF
KQLQSPTNSFVMSLAVADCLVGLVVMPYSMIRTVEGCWYFGALFCQLHSSLDVMLCTASI
FHLSCIAFDRYYAVCNPLVYSLKMSRSRVALLIVVCWAVPMLISFGPIMLDLHIAGVDIL
LPKDVCVFLVNRIYAVMASMVAFYLPMAIMLVAYWKIFKAAKRQAKQISAMESQMAAGVG
KDSSKKQRHRNTMRRERKAAKTLGIIMGVFLIFWMPFFTVNIVDPFIEYSTEVVVWDIFL
WLGYINSSLNPFLYGFFNRSFRRAFLMFIGCRVCLPGSSPGMELSHTRKDANERADKS
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atggataacggcagcttgggattgcttggagatgctaacacatctcttcagattgaactt
cagtcctgtactacagtgaggaaccaggtttctcgcattttcctgtatgccttcctctct
gttggcatcgcctgcacagtggtgggaaatttcctggtggtcttgtccatcgcctacttc
aagcagttgcaatcacccacaaattccttcgtcatgtccttggcagtggctgattgcctc
gttggcctggtagtgatgccttatagtatgattcggactgtggagggatgctggtacttt
ggtgcccttttttgtcaacttcactcgagcctagatgtgatgctgtgcactgcctccata
ttccatctcagctgcattgcctttgaccgctactatgctgtctgcaacccgctagtttac
tctttaaagatgtctcgtagtcgggtagctctcctcattgttgtgtgttgggctgttccc
atgctcatttcctttggccccataatgctagatcttcatattgctggtgtggacatcttg
ctccctaaagatgtatgcgtattcttggtcaatcgaatttatgctgtcatggcttccatg
gtagccttctacttgccaatggctatcatgctagtagcctactggaagatcttcaaagcc
gccaaaaggcaggccaaacagatcagcgccatggaaagtcagatggcagctggagtggga
aaagactcgagcaagaaacaaagacaccgaaacactatgaggagggagagaaaggctgca
aaaactttgggtatcatcatgggagttttcctaatcttctggatgcccttctttacagtc
aacattgtggacccgtttattgaatacagcacagaagtggttgtttgggatatatttttg
tggctaggctatatcaactcatctctaaatcccttcctgtatggttttttcaaccgttcc
ttccgcagggcattcctcatgttcattggctgcagggtatgcctgcctggatcctcccct
gggatggagctatctcacactaggaaagatgcaaatgagcgtgcagataaatcatga

DBGET integrated database retrieval system