KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664155Help
Entry
111664155         CDS       T06058                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04068  FoxO signaling pathway
slal04110  Cell cycle
slal04218  Cellular senescence
slal04350  TGF-beta signaling pathway
slal04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111664155 (tgfb2)
   04350 TGF-beta signaling pathway
    111664155 (tgfb2)
   04068 FoxO signaling pathway
    111664155 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111664155 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    111664155 (tgfb2)
   04218 Cellular senescence
    111664155 (tgfb2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    111664155 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:slal04052]
    111664155 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:slal00536]
    111664155 (tgfb2)
Cytokines and growth factors [BR:slal04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   111664155 (tgfb2)
Glycosaminoglycan binding proteins [BR:slal00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   111664155 (tgfb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Motif
Other DBs
NCBI-GeneID: 111664155
NCBI-ProteinID: XP_023274402
Position
Unknown
AA seq 419 aa AA seqDB search
MNLCVVGLLLALDLATVALSLSTCSTLDMDQFKKKRIEAIRGQILSKLKLTSPPEDFPEP
EEVSRDIVAIYNSTRDLLQEKANERAATCERQRSEEEYYAKEVHKIDMQPFYPSENVISP
THFNPYFRRLTFDVSSMEKNASNLVKAELRIFRLQNPGARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTQTEGEWLSFDVTEAVSEWLNHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFIHGGDLKVFKRRRHSARAPHLLLMLLPSYRLESQSQSQSQAQH
KNHRSKRALDAAYCSKNVQDNCCLRSLYIDFKKDLGWRWIHEPKGYEANFCAGACPYLWS
ADTQHSKVLGLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaacctgtgtgtcgtcggtcttctcctcgcgctggatttagccaccgtggcgctcagc
ctgtccacatgcagcacgctggacatggatcagttcaagaagaagcgcatcgaggccatc
cgagggcagatcttgagcaagctcaagctcaccagccccccggaggacttccccgagccc
gaggaggtgtcccgggacatagtggccatatacaacagcacgcgggacctgctgcaggag
aaagcgaacgaacgcgcggcgacgtgcgagcggcagcgcagcgaggaggagtattacgcc
aaggaggtacacaagatcgacatgcagcccttctacccgtcagagaacgtcatctctccg
acacacttcaacccttacttcaggcggctgacgtttgacgtgtcgtccatggagaagaat
gcgtcgaacctggtgaaggctgagctcaggatcttccgtctccagaaccccggagcccga
gtgtccgagcagcgcatcgagctctaccagattttaggacacaaagacctgacgtccccg
acacagcggtatatcgacagcaaggtggtacgaacacagacggagggagagtggctgtcg
ttcgacgtcacagaggcagtgagcgagtggctgaaccacagagacagaaacagtggattc
aagatcagcctgcactgcccctgctgcacgtttgtaccgtcaaataactacattattccc
aacaagagcgaggagctggaggcgcggttcgcaggtattgacgacagcttcatccacggc
ggcgacctgaaggtgttcaagaggcggcggcacagcgctcgggctccgcaccttctgctc
atgctgctgccttcatacaggctggagtcccagtcccagtcccagtcccaggcccagcac
aagaaccatcgatccaagagagccctggatgctgcctactgctccaaaaacgttcaggac
aactgctgcttacggtcgctctacatcgacttcaagaaggacctgggctggaggtggatc
cacgagccaaagggatatgaggccaacttctgtgccggggcgtgtccgtatctgtggagc
gccgacacccagcattccaaggtgttaggcctttacaacaccatcaaccctgaagcatca
gcatcaccctgctgcgtctcccaggacctggagcccctcaccatcctctactacatcggc
aagacccccaagatagagcagctctccaacatgaaggtcaagtcctgcaagtgcagctag

DBGET integrated database retrieval system