KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111664988Help
Entry
111664988         CDS       T06058                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal03040  Spliceosome
slal04010  MAPK signaling pathway
slal04141  Protein processing in endoplasmic reticulum
slal04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:slal00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    111664988
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    111664988
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111664988
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111664988
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:slal01009]
    111664988
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:slal03041]
    111664988
   03009 Ribosome biogenesis [BR:slal03009]
    111664988
   03110 Chaperones and folding catalysts [BR:slal03110]
    111664988
   04131 Membrane trafficking [BR:slal04131]
    111664988
   03051 Proteasome [BR:slal03051]
    111664988
   03029 Mitochondrial biogenesis [BR:slal03029]
    111664988
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slal04147]
    111664988
Protein phosphatases and associated proteins [BR:slal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     111664988
Spliceosome [BR:slal03041]
 Complex B
  Other components
   Prp19 complex
    111664988
 Complex C
   Prp19-CDC5 complex
    111664988
Ribosome biogenesis [BR:slal03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    111664988
Chaperones and folding catalysts [BR:slal03110]
 Heat shock proteins
  HSP70 / DNAK
   111664988
Membrane trafficking [BR:slal04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    111664988
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    111664988
Proteasome [BR:slal03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    111664988
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    111664988
Exosome [BR:slal04147]
 Exosomal proteins
  Proteins found in most exosomes
   111664988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C
Motif
Other DBs
NCBI-GeneID: 111664988
NCBI-ProteinID: XP_023275598
Position
Unknown
AA seq 649 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGIFQHGKVEIIANDQGNRTTPSYVAFTDNERLIGDAAKNQVA
MNPTNTVFDAKRLIGRKFDDPVVQSDMKHWPFKVVNDSTKPKVEVEYKGEIKTFYAEEIS
SMVLIKMKEISEAYLGKSVTNAVITVPAYFNDSQRQATKDAGVIAGLNVLRIINEPTAAA
IAYGLDKKVGGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIGEFKRKFKKEINNNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGTDFYTSITRA
RFEELNADLFRGTLEPVEKALRDAKMDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGRDLN
KSINPDEAVAYGAAVQAAILAGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNILGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEQFKAEDEAQKDKVTAKN
SLESLAFNMKSTVEDEKLQDKINPEDKKAIVDKCNEVIAWLDKNQMAEKDEYDHQQKELE
KVCNPIISKLYQGGMPEGAPGGMPGGMPGGFPGGAGGGSASGPTIEEVD
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggaccagcagtaggcattgatctgggcaccacatactcctgtgtgggcatc
ttccaacatggcaaagtggagatcatagctaatgaccaaggaaacaggaccacgcccagc
tatgtggccttcacagacaatgagagactgattggagatgctgccaagaaccaggtggcc
atgaatccaaccaacactgtatttgatgctaagcgtctgattggccgtaagtttgacgat
cctgtggtgcaatcagacatgaagcactggcccttcaaggttgtgaatgactctaccaag
cctaaggtggaggttgagtacaagggtgagatcaaaaccttctacgctgaggagatttcc
tcaatggtcctcatcaagatgaaggagatctctgaagcttatcttggcaagtctgtaacc
aatgcggttataacagttcctgcttacttcaatgactctcagcgtcaggccaccaaagat
gctggagtcattgctgggcttaacgtgctgcgcatcatcaatgagcccactgctgcagcc
attgcttatggcctggacaaaaaggttggcggtgaacgtaatgtccttatatttgacctt
ggaggtggtacttttgatgtgtcaatcctgacaattgaggatggcatctttgaggtcaag
tccacagccggtgacactcacttgggcggtgaggactttgacaaccgcatggtaaaccac
ttcattggtgagttcaagcgcaagttcaaaaaggaaatcaacaacaacaagcgagctgtg
cgacgtctgcgcacagcatgcgagcgtgctaagcgcaccctctccagcagcacccaggcc
agcattgagatcgattcactctatgaaggaacagatttctacacttccatcaccagggct
cgttttgaggagctaaatgcagacctgttccgtggaaccctggagcctgtggagaaggcc
ctgagggatgccaagatggacaagagccagatccatgacattgtcctggtcggtggctcc
actcgtatccccaagattcaaaagctactgcaggacttcttcaatggccgtgatctcaat
aagagcatcaaccctgatgaggctgtggcctatggtgcagctgtgcaggctgccatcttg
gctggtgataagtctgagaatgtacaggacctgctcctgctggatgtaacgcccctgtcc
ctgggaattgagactgctggaggagtaatgactgtccttatcaaaaggaacaccaccatc
cccaccaagcaaacccaaacctttaccacctattcagacaaccaacctggtgtgctcatt
caggtttatgaaggtgagagagccatgaccaaggacaataatatcctgggcaagtttgag
ctgactggtattccaccagctccccgcggggtccctcagattgaggtgacctttgacatt
gatgccaatggcatcctcaatgtgtctgctgtggacaaaagcaccggaaaggagaacaag
atcaccatcaccaatgataaagggcggctgagcaaggaggatattgagcgtatggtgcag
gaggcagagcagttcaaggctgaggatgaggcccagaaagacaaggttacagccaagaac
tccctcgagtctctggccttcaacatgaagagcactgtggaggacgagaaactccaagac
aagatcaaccctgaggacaaaaaggccattgtagacaagtgcaatgaggtcattgcctgg
ctggacaagaaccagatggcagagaaggatgagtacgatcaccagcagaaggaactagag
aaagtgtgcaaccccatcatctcaaagctataccagggtggtatgccagaaggagcgcct
ggagggatgccaggaggaatgcctggtggtttccctggtggagccggaggtggctccgcc
tctggcccaactattgaggaggtcgactga

DBGET integrated database retrieval system