KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111666973Help
Entry
111666973         CDS       T06058                                 

Definition
(RefSeq) tripeptidyl-peptidase 2-like
  KO
K01280  tripeptidyl-peptidase II [EC:3.4.14.10]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:slal01002]
    111666973
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:slal03110]
    111666973
Enzymes [BR:slal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.10  tripeptidyl-peptidase II
     111666973
Peptidases and inhibitors [BR:slal01002]
 Serine peptidases
  Family S8: subtilisin family
   111666973
Chaperones and folding catalysts [BR:slal03110]
 Intramolecular chaperones
  Subtilisin family
   111666973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S8
Motif
Other DBs
NCBI-GeneID: 111666973
NCBI-ProteinID: XP_023278284
Position
Unknown
AA seq 130 aa AA seqDB search
MAAHSTEEPFPFHGLLPKKETGATSYLTRFPEYDGRGVLIAILDTGVDPGAPGMQVTTEG
KPKIVDIIDTTGSGDVNMTTVAEPKDGIITGLSGRILKIPPAWVNPSGKYRIGVKNGYEF
FPKALKERIQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcattctaccgaagaaccgttccctttccacgggctgctccccaaaaaagaa
accggcgccacgtcttacctcaccaggttccccgagtacgatggccgaggagtgctcatc
gctatcctcgacaccggcgtggatcccggggcccccggcatgcaggttacaactgagggg
aagccaaagatcgtcgatatcatcgatacaacaggcagcggtgacgtgaacatgaccaca
gtggcggaacctaaagatggtataatcactggcctctctggtagaatacttaagatccct
cctgcctgggtcaatccatcagggaagtatcgcattggagttaaaaatggctatgagttc
ttccctaaggcccttaaagagagaatacag

DBGET integrated database retrieval system