KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111670415
Entry
111670415         CDS       T06058                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111670415
Enzymes [BR:slal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     111670415
SSDB
Motif
Pfam: AstE_AspA Coa1
Other DBs
NCBI-GeneID: 111670415
NCBI-ProteinID: XP_023282892
Position
Unknown
AA seq 309 aa
MECVSFSPLSRVAICGGTHGNEMSGVYMAREMQKQKVEKAGSVFITTVLANPRAVDACKR
YTDTDLNRCFTDALLSSPITDSTSYELRRAQELNAQLGPKGSEEAVDLICDLHNTTANMG
LCLIFYSLDWITMHIYKYIQSKITSAPVRAIQLDIPISEAYSLESVGKHGFAIEVGPQPG
GVLRADIFNMVKEAVDLTIEWLQLFNSGSTFEGGEVEAYTLTKSVDYPRDPMTNEITAAI
HPKLQDNDFKLLQPGDPIFLSFSGKTVKHEGEELYPFFVNECAYYEKKIAFHLARKITLT
FPSVSVKKD
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagtgtgtctctttctcgccactgtcccgtgtagccatttgtggtggcacccatgga
aatgagatgtcaggggtgtatatggcgagagaaatgcagaaacagaaggtggaaaaggcc
ggatctgtctttattaccactgtcctagcaaacccacgtgctgtggatgcttgcaaaaga
tacacagatacagacctcaaccgctgtttcaccgacgccttgctgagttccccaataaca
gattcaacatcgtatgagttgaggcgagcccaggagctgaatgctcagcttgggcccaaa
ggaagtgaagaggctgtggatctgatctgtgatctccacaacaccactgccaacatgggc
ctgtgcctcatcttttactccttagactggatcaccatgcacatttacaaatacatacag
agcaagataacctctgcgcctgtgagagcaatccagctggatatacccatctctgaggct
tactccttagagtcagtgggcaaacatggctttgcaattgaggtcggtcctcaacccgga
ggtgtgctcagagctgatatctttaacatggtgaaagaggcagtggacctcacaatagaa
tggcttcagctattcaattctggaagtacttttgaaggaggtgaagttgaagcatacact
ctgacgaagagcgttgactacccaagggatccaatgaccaatgagatcactgctgccatt
caccccaagctacaggataatgacttcaagctcctccaaccaggtgaccccatattcctg
tcattttctggcaagactgtgaagcacgagggagaggaactctaccctttctttgtcaat
gaatgtgcctactacgagaagaagattgctttccatttagctcgaaagatcactctgacc
ttcccgtctgttagtgtgaagaaggactga

DBGET integrated database retrieval system