KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111671246Help
Entry
111671246         CDS       T06058                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
  KO
K08765  carnitine O-palmitoyltransferase 1, liver isoform [EC:2.3.1.21]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00071  Fatty acid degradation
slal01212  Fatty acid metabolism
slal03320  PPAR signaling pathway
slal04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    111671246
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111671246
   03320 PPAR signaling pathway
    111671246
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:slal03029]
    111671246
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     111671246
Mitochondrial biogenesis [BR:slal03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    111671246
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf CPT_N
Motif
Other DBs
NCBI-GeneID: 111671246
NCBI-ProteinID: XP_023284092
Position
Unknown
AA seq 787 aa AA seqDB search
MAEAHQAVGFQFTVRPDGVDLKLSQEVIKNIYLSGVTAWKKKAIQFKNGVLAGVYPASPS
SWLIVVIAMMSSLYIRIDPSLGMIDAIKDNLPQRDYMSVQTRAVLSAILFATGLWLFLIY
LLRYTLKALLSYHGWIFESHGKMSTSTKVWLSLVKMFSGRRPLLYSFQASLPRLPVPSVD
DTIHRYLESVRPLLDGEQYNQMEILANDFKDSKATQLQRYLILKSWWATNYVSDWWEEYI
YLRGRSPIMVNSNFYIMDLLYMTPTHRQAARAGNVVHAMLQYRRKLERGEHAPLRAVGTV
PMCSTQMERMFNTTRIPGIETDIVQHLTDRKHLIVYHKGRFFQVWLYTGGRHLLPSELET
QFQKILNDTSEPQPGELKLAALTAGNRVPWARARIKYFSLGVNKVSLDAIESAAFVLTLD
DEPQGYDSAKTNSLDSYAKSLLHGKCYDRWFDKSFTLISYPNGKMGINAEHSWADAPVVG
HMWEYVLATDCFHLGYTEEGHCKGDVNKGLPHPTRLQWQIPKECQEIIGTSYLSAKQIAD
DVDFHGYLFSEFGKGLIKKCKTSPDAFIQLALQLAQFRDQGVFCLTYESSMTRMFRDGRT
ETVRSCTSEAVAFVRAMEDASGTNVQRLALFRRAADKHQNMYRLAMTGSGIDRHLFCLYI
VSKYLGVDSPFLEKVLSEPWKLSTSQTPQQQLNLVDINKFPKYVGAGGGFGPVADDGYGV
SYIIVGENLITFHISSKFSSPDTDSCRFGQHIRKAMLDIQGLFKPENDKKMVEHGKLVQL
ENGKKHI
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcgcatcaggcggtgggcttccagttcaccgtgcgccctgatggtgtggac
cttaagctgagtcaagaggtcatcaaaaacatctacctatcaggagtgacagcatggaag
aagaaggccatacaattcaagaatggagtattggctggagtctatccagccagtccgtcc
agctggctgatagttgtgattgccatgatgagttccttgtatatacgcatagacccctct
ctaggaatgattgacgccatcaaggataacctaccacaaagagactatatgtcagtgcag
acccgagcggtgctgagtgccatcctctttgccactggtctgtggctgttcctcatctac
cttttgagatacactctcaaagctctgctctcctaccatggctggatttttgaatcccat
ggaaaaatgagcacgtctaccaaagtgtggctgagcctggtgaagatgttctctggacgc
agaccgctgctttacagtttccaggcgtctttacccaggctccctgtgcccagtgtggat
gatacaattcacaggtacctagagtcagttcgtcctctgctggacggtgagcagtataac
caaatggagattttggccaatgactttaaagattccaaggcaacccagctgcagagatac
ttaatcctaaaatcctggtgggcaacaaattatgtaagtgactggtgggaggagtacatc
tacctcagggggaggagtcctatcatggtgaacagtaacttctacataatggacctcttg
tacatgaccccaacacaccgacaggctgcgcgggcggggaatgtggtccatgccatgctg
cagtacagacgcaaactggaacgtggtgaacatgcaccgctgagggctgtggggactgtt
cctatgtgttctactcagatggagaggatgtttaacaccactcgcatccccggcattgaa
acagatattgtgcagcacctgaccgaccgtaagcacctgattgtctaccacaagggccgg
ttcttccaagtgtggctgtacactggagggcgccacctcttacccagtgaacttgagact
cagtttcaaaagatcctcaatgatacatcggaaccccagccgggagaactcaaattagct
gccctgactgcaggaaacagagttccatgggctcgggctcggattaagtatttcagcctg
ggagtaaacaaagtgtccctggatgccattgagtcagctgccttcgtcctgacactggat
gatgagccgcagggttatgactctgcaaagaccaattcactcgatagttacgccaaatcc
ctgctccatggaaaatgttacgacaggtggtttgacaagtctttcaccttgatctcttat
ccaaatggaaaaatggggataaatgctgaacattcttgggctgatgcaccagttgtagga
catatgtgggagtatgtccttgcaacagactgcttccatcttggctacacagaagaggga
cactgtaaaggggatgtgaacaaaggcctgcctcatcccactcgactgcagtggcagatt
ccaaaggagtgtcaagagatcattgggacctcatacctatcggccaagcagatagctgat
gacgtggacttccatggttatctcttttctgagtttgggaaaggtcttatcaagaagtgc
aagaccagccctgatgccttcatccaactggccctgcagttggcacagttcagggaccag
ggagtgttttgtctgacgtacgagtcatcaatgactcgtatgttcagagacggtcggacg
gagacggtacgctcctgcacctctgaggctgttgcatttgtcagagccatggaagacgca
agtggaacaaatgtccagagacttgccctgtttcggagggcagcagataaacatcaaaac
atgtatcgtctggccatgactggttctggtattgaccgtcacctcttctgtctctacata
gtgtccaaataccttggcgttgactcaccatttcttgagaaggtgctttcagagccctgg
aagttgtctaccagccagactccacagcagcagctcaatttagttgacatcaacaagttc
cctaaatatgtgggtgctggtggaggatttggcccagtggctgatgatggctatggtgtg
tcttatatcattgttggggaaaacctcatcacattccacatctcaagcaagttctctagc
cctgacacagactcatgccggtttggtcagcacattcggaaggccatgcttgatatccaa
ggacttttcaagcctgaaaatgataagaagatggtggagcatggaaagcttgtgcagctg
gaaaatgggaaaaagcacatataa

DBGET integrated database retrieval system