KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111671959Help
Entry
111671959         CDS       T06058                                 

Definition
(RefSeq) tumor necrosis factor ligand superfamily member 6-like
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04010  MAPK signaling pathway
slal04060  Cytokine-cytokine receptor interaction
slal04068  FoxO signaling pathway
slal04210  Apoptosis
slal04217  Necroptosis
slal05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    111671959
   04068 FoxO signaling pathway
    111671959
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111671959
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    111671959
   04217 Necroptosis
    111671959
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    111671959
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slal04147]
    111671959
   04052 Cytokines and growth factors [BR:slal04052]
    111671959
   04090 CD molecules [BR:slal04090]
    111671959
Exosome [BR:slal04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   111671959
Cytokines and growth factors [BR:slal04052]
 Cytokines
  Tumor necrosis fators
   111671959
CD molecules [BR:slal04090]
 Proteins
  111671959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF C1q
Motif
Other DBs
NCBI-GeneID: 111671959
NCBI-ProteinID: XP_023284981
Position
Unknown
AA seq 302 aa AA seqDB search
MPWPFKTEVLRQQYTPPSCRSDTCTHSLSHSRTCNMSCDQSYPFPQVFLVDGGGSRQNSD
QPPSLVPCWSFPPAQERARSREKSRGFMGVSPSLALVVLLLFLLVFAALGFEAYQIHNMQ
MELKQMRQDQPETEFNTAQKQIGFPEPEVRGQDTDNRPAAHMMGRIERGEFRKTLRWEPR
VGRAFVSGGVTYQIEDGGLQVNESGLYHIYSRVELIFRNCSPTSSFIHSVFLRRAKHLSP
LTLMEAHRAGFCSKHLENSWTTESYLSAALKLQKYDKVFVNVSHPSLLSHAHYGNFFGLY
KV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgccttggccttttaagactgaggtgctcagacaacagtacacacctccttcatgcaga
agcgatacatgcacacacagtttgtctcacagtaggacctgcaacatgagctgtgaccag
agctatcccttcccacaggtgttcctcgtggatggaggtggaagtcgtcagaactctgac
cagcctccgagtcttgtgccctgctggtcattcccgccagcccaggagagggcgaggagc
cgtgagaagagtcggggcttcatgggagtcagccccagtctggccttggtcgtgctgttg
ctgttcctgcttgtgtttgcagccctggggtttgaagcctaccagatccacaatatgcag
atggaactgaaacagatgagacaggatcaacctgagacagagtttaatacagcacagaag
caaattggtttccctgaacctgaggtgcgtggacaagacacagacaacagacctgcagca
catatgatggggcggattgaaagaggggaattccggaagactttgcgatgggagccgagg
gtaggtcgggcgttcgtatctggaggagtgacttaccagattgaagatggtggtctgcag
gtcaacgagagcggactctaccacatttactcacgagtggagctgatctttaggaactgt
tcccccacatcctcgttcattcactctgtgtttttgaggagagcgaaacatttgtcacct
ctgaccctgatggaggcccacagagcaggtttctgctccaagcacctggaaaactcttgg
accacagagagttacctcagcgctgccctaaagctgcagaaatacgacaaagtttttgtg
aatgtatcgcacccctctcttcttagtcatgcacattatggcaacttctttggcctctac
aaagtctga

DBGET integrated database retrieval system