KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111672193Help
Entry
111672193         CDS       T06058                                 

Gene name
wnk2
Definition
(RefSeq) serine/threonine-protein kinase WNK2
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:slal01001]
    111672193 (wnk2)
   01009 Protein phosphatases and associated proteins [BR:slal01009]
    111672193 (wnk2)
Enzymes [BR:slal01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     111672193 (wnk2)
Protein kinases [BR:slal01001]
 Serine/threonine kinases: Other
  Wnk family
   111672193 (wnk2)
Protein phosphatases and associated proteins [BR:slal01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     111672193 (wnk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C
Motif
Other DBs
NCBI-GeneID: 111672193
NCBI-ProteinID: XP_023285295
Position
Unknown
AA seq 2832 aa AA seqDB search
MEPESNSHSGAHQDLKYPSVPNSQCELAMGDGNISLVDSLVRGGSDPSAYPSSSYQRNVH
QRFIRRSLWFSDTDEQAFEAPECDNRSKILNINLRTIVDRTLGTSCGVQEGSSTESQGGQ
KDSATESASAEEEKEKGGDALNVTCSDGAKTAIKAASEENEEEAEMKAVSTSPGGRFLKF
DIELGRGSFKTVYKGLDTETWVEVAWCELQDRKLSKVERQRFKEEAEMLKGLQHPNIVRF
YDFWESSLKGKKCIVLVTELMTSGTLKTYLKRFKVMKPKVLRSWCRQILKGLHFLHTRTP
PIIHRDLKCDNIFITGPTGSVKIGDLGLATLKAASFAKSVIGTPEFMAPEMYEEHYDEAV
DVYAFGMCMLEMATSEYPYSECQNAAQIYRKVTSGVKPASYNKVMDPEIKEIIGECICQK
KEERYTIKDLLNHAFFAEDTGVRVELAEEDDGKKASIALKLWVEDHKKLKGKYKESGAIE
FAFDLEKEVPEVVAQEMVESGFFHESDAKTVGKSIRDRVALIKWRRERTVSAAVALNQGE
GGHRVQMTPSQGISAGAAHVGQPPLQEPEEPEVDQHNRLRNLPTSATSVTSDGTLDSGMG
STVYSDSHSSQQSVLYQSLLEPITMATQQCQSSNPLLTDRPHSCEKGEIWGATLSPELRT
RLGAAARRGSAPVIDTHRENHIAQLHALSQFQRSISPTPTVLENQSELSPSDFHSEAEDG
FPSQSALPMLQVSPVSSPSEYRRLSDTSIRPTSEASENLTLPMPSVRRHSDLSSLLSITS
HHNHHLGMHKSHICQACLSLLLRSREGSHRHPSVAMPTHQCPCDLKYCPSSGGTVTTPGY
GRLKGSGDCSDFSLLQKSLFNIISRKAAPCHTTPTQASLLDPSAAHRPACSDGDGSLKSR
VLSGNSVRDQEPLQDCEDRFCAGEQQVTRAVGVTNSAGHQNQPPVQGLPSSSTAVHTPLQ
YLQPGHSYPAAPYAGQPSVATPAPGSVCLVNIQHAGNSAGYAPPSVQQTQAAASISASAV
PQHVAQSHQAPGHQQQQATAASSLTFPLQGHQTCQNCVAPPQQQAQSASGYPTPVQQQTT
AAAAAAGNLPAQQPAQSYSLVSVAPTMAATAQCHPAQAPSALQHIQATVKLPSQQPGQSS
STPALYSQQIPIQQEHQQPLPQNTQSRIQQTQNAGQAYIQPQLQHNQDTVRPIHQQMAQQ
PTHQAQSLQSPGQQQLQTSTLQQHSQKAVQTAVPQQSQGVSQSTVQQVQTPASQPHLTAT
PVVQVAGTHQSYPAAGVPDAASQSYAHSTFNALQQQTAPSQSQYQPAQSIAAPQTYGGAT
QVVTPQSLPASSLHSQPAHVVQQFQPYLCIAAFLNQNIPVGQSISQLGQDGQGHGQNLSQ
SASSMLAQPLLPQQSMAQATVHQQLQPLQISTSLPPTHPPQFPSQYPTVQVMTAVTDCES
SYPQSCTAPHPSTSSSVNHVFLSPGQTLPVTPSVSPLSPLHIENALVSPIPVSLIPSPSP
MLGKMGPTSPQHQPTTALQQSVRSEASHSQPAFISALTTHPIHTHISLSQNTHPPTNGST
QPLIQQAPQQAQISHPELVPSAQPVQPTLFSSPMQNGPDPGTVTTAAHLDNNNQCQLALQ
AQAQSQLQSQIPVLQTSESQRASSGSASSSLTQQKHLTTLTGAAGPGPTDTSTEDPASEK
HSAGQSYDSVNSDATSGKEMSDGCEGTQGSKGEGKVRKHHRRSTRTRSRQEKISRPKLSM
LNVCNTGDKMVECQLETHNHKMVTFKFDLDGDAPEEIAIYMVENDFILPLEKDVFIEQLK
DIVDKAEDMLSEDTEGERNSDQGGSPKQSEGADTLGTEASAPSTPQLVYQQNVLHTGKRW
FIICPVAETPMVDKEKTTSHTSTAQESEKSASSSVRPNSNTTAMTTPVASLSSQSQSSSS
SLPSAAQTSVQPPGQNLGKARVQQTQPSVTKHAHAAAGVSHQNSLPVEEPCISAVSMVTD
MPCCAIVPPVSLDVNANDKGAVGSLVSSQTNQPNEKASPTGELPPQLGSHQSVVLQQPYA
TSMQPGTVTSQPQSPAHQTSQNSQLSSHQQPAGGGPGESDSEGPRRVEFVDRTIKTLDEK
LRNLLYQEHAPSQPSSTTSDPQASSAEGVSSPPVSDGQSTEGALTKKKGDPLPQIPERTE
SVGALSDSAVAAASRALKGRDVTASSSSYSSKNRFQIIPTPPDVICRLEKSKTSYSTCSS
AAPSSGSGGSHSQIQGAGSKEKGSVAVGRSSVTAAEDENAAISKTLSCNRYSAPPNFFHA
TPTSSPDVTPRHIPRAQTIDTPTHHYYHHSSHLCSDSADEDSSSIALPPAHPAPPPHALS
EHSGSDLMKRAVAFLRRSGRSKSEQSSDSPSRQPVAMNGHAPAPAAGHAHSSYISSDNDS
EFEDADMKKELQKLREKHMKEISELQAFQRSEIERLYKELGKTLPPNVGLLHAAPPSGRR
RRASKHKLKAGKLLNPMVQQLKNNLNTTTERKGESAASSSGSPAKSSILSDGSAHSSGSS
SSANQPNSAPEQVHTQQPCSLKGSFSSDNIYSGLHSDGMATQAGPGQGWTVYHQTSERVT
YKSSSKPRTRFLSGPVSLSIWSTLKRLCLGKERSSRSSLNTTTAQTASSQTQPQLTTATP
SPSPQPITRLAQVQTNNSNNKRGTFTDDLHKLVDDWTKETVAAANQPRPSLNQIKQQRRQ
RDLECRAPPMGAATREVKCHVGPSKFQLPLSCPLTAALGPGMPTSLAPSSSAMLPPGYLL
PPGSYGGMVPGPLYPQQWPGMPSPVGSVGPVGLLGAARMMPYATMANPGIQAFPLVMHKP
ENGPCPKTTRTT
NT seq 8499 nt NT seq  +upstreamnt  +downstreamnt
atggagccggagtctaattcacactccggggcccaccaagacctgaaatatccatccgta
cccaactctcagtgtgaactggccatgggtgatggaaatatcagtcttgtggactcacta
gtgaggggtgggagtgaccccagtgcatacccctcatccagctatcagaggaatgtgcat
cagagattcatcaggagaagtctgtggttctcggacacagatgagcaggcctttgaagca
cctgaatgtgataacaggagtaagatcctaaacataaacctgcgaacaatagtggacagg
actctggggactagttgtggggtacaagagggttccagcactgaaagtcaaggtgggcaa
aaagacagtgcaacagagagcgccagtgccgaggaagagaaggaaaaaggtggagatgca
ttaaatgttacatgcagcgatggtgctaaaactgctatcaaggcagccagtgaggagaat
gaggaagaagcagagatgaaagcagtctccacatctccaggaggacggttcctcaaattt
gacattgagctggggagagggtccttcaagacggtttacaagggcctggacactgagacc
tgggtggaggttgcctggtgtgagctgcaggatcgtaagctgtcaaaagtggagcgtcaa
cgctttaaggaggaagcagagatgttaaagggtcttcaacatcccaacattgtccgtttc
tatgacttctgggagtcatcccttaaagggaagaaatgcattgttctagtaacagagctc
atgacgtcagggaccttaaaaacctatctaaagcgtttcaaggtaatgaagcccaaggtg
ctgaggagctggtgcagacagatcctgaaaggcctacactttctccacaccaggacccca
cccatcatccacagagacctcaaatgtgataacatctttatcactggacctacagggtca
gtcaagatcggggatttaggacttgcaacactcaaagcagcttcctttgccaagagtgtc
ataggcacccctgagttcatggctccagagatgtatgaggagcactatgacgaggcagtg
gatgtctacgcctttggcatgtgtatgctagagatggccacctcagaatacccctactcc
gaatgtcagaatgctgctcagatttaccgcaaagtcacaagcggagtgaagccagccagc
tacaacaaggtcatggatcctgaaatcaaggagattattggggaatgtatctgccaaaag
aaggaggagcggtacaccatcaaggacttgttgaaccatgctttctttgctgaggacaca
ggtgtaagggttgagctagctgaggaggatgatgggaaaaaggcctcaatagccctcaaa
ctgtgggtggaggaccacaagaaattaaaagggaagtacaaggagagtggagccatcgag
ttcgcatttgacttggaaaaggaggtgcctgaggttgtggcacaagaaatggtggagtct
ggcttcttccacgagagtgatgctaagactgtgggaaagtcgatcagggaccgtgtggca
ctgatcaaatggagaagagagagaacagtgtctgctgcagttgcattgaatcagggtgaa
ggaggacacagggtccagatgacaccgtctcagggcatctctgctggggctgcacatgta
ggacagccccctttgcaggaaccagaggagccagaggtagaccagcacaacaggctgcgt
aacctaccaaccagtgcaacctcagtgacatcagacggcacacttgacagtggcatgggc
tccactgtgtactcagactcccacagcagccagcagagtgtcctataccagtccctgctg
gagcctattactatggcaacgcagcagtgccagagcagtaaccctcttctgacagatcgg
cctcactcctgtgaaaagggtgaaatatggggcgcaacactgagcccagagctcaggact
cgattgggagcagcagcccggagaggaagtgcccctgtcattgacactcacagggaaaac
cacatcgctcaactccacgccctcagtcagtttcagagatcaatcagtcccacccccaca
gtactagagaaccagtcagaactcagcccctctgactttcactcagaggctgaggatggt
ttcccctctcagagtgctctgccaatgctgcaggtctcccctgtctcttcaccctctgag
taccgccgccttagtgacaccagcatcagaccaacatcagaggccagtgagaacttaaca
ctgcctatgccaagtgtacgcagacactctgaccttagtagtcttctgagtataacctct
catcataaccaccatcttggaatgcataaatcccacatttgccaggcctgcctctctttg
cttttgaggtcacgagagggcagccaccgccacccttctgttgccatgccgacacaccag
tgtccatgtgacttaaaatactgcccgtcctctggtggaacagtgaccacccctggttat
ggtcggctgaaaggttccggtgattgctctgatttctcactgctgcagaagtccctgttc
aatataatcagccgcaaagcagccccttgtcacaccacacccacccaagcctcactgctg
gacccctcagccgcccacaggcctgcttgcagtgatggagacggcagtctgaagagtcgt
gtcttgagtggcaattcagttcgggaccaagaacccctccaggactgcgaggatagattc
tgtgctggagagcagcaagttacccgggctgtgggagtgaccaattctgcaggtcaccag
aatcaaccacctgtccagggcctgccttcttccagcacagcagtgcacacaccactgcag
tacctccagcctggacacagctaccctgctgctccatatgctggtcagcccagtgttgca
acaccagccccaggtagtgtatgtttagtcaacatccagcatgcaggcaactctgctggt
tatgcacctccaagtgtgcaacagacccaagctgcagcaagtatttcagcatcagctgtg
ccacaacatgttgcacagagccaccaagcaccaggccatcaacagcagcaggcaactgca
gcaagctctttaacttttcctctgcaagggcatcaaacgtgtcagaactgtgtggctcca
cctcaacaacaggctcagtctgcatcaggatatcctactccagttcagcaacagactaca
gcagcagcagcagcagcaggcaacctgccagcacagcagccagcacaaagctactctctt
gtatctgtagccccaactatggcagccacagcccagtgtcatcctgcacaagctcccagt
gcactgcagcacatccaagctacagtcaaactgccaagtcagcagcctggtcagagctcc
tccacaccagcactttacagccaacagatacccattcagcaagagcaccaacagccctta
ccacaaaatactcagtccaggatacaacaaacacaaaatgctgggcaggcttatattcaa
cctcaactccagcataaccaagatactgtgcgtcccatacaccaacaaatggcacaacag
cccacccaccaagctcaaagtctccagtctcctggtcagcaacaattgcaaacctcaact
ctacagcagcacagccagaaagctgtgcaaacagcagttccacagcagagccagggtgta
tcccagtccacagtccaacaggttcagacccctgcttctcagcctcatctcacagcaacc
ccagttgtgcaggttgcaggcacacatcagagttaccctgctgcaggtgtgcctgatgct
gcctctcagagctatgcacattctaccttcaatgcgctgcagcaacagactgctccatct
cagagccagtaccagcctgcacagtctattgctgctccacagacctatggaggagctacc
caggtagtgactcctcagagccttccagcctcttccctccatagccagcctgcacatgtt
gtccagcagtttcaaccctatctttgcatcgctgctttcctgaaccagaatattcctgtt
ggtcaaagcatttcacagcttggacaagatggacagggccatgggcagaatctcagccag
tctgcttccagtatgctggcccagccacttcttcctcaacagtcaatggctcaggctact
gtccatcaacaactccaacctctgcagatatcaacctctctaccaccaacacacccaccc
cagtttccctcacagtatcccacagtccaggtgatgacagctgtgactgactgtgaatcc
tcctatcctcaatcctgcactgcccctcacccttcaacctcctcttctgttaatcacgtc
tttctttctcctggacagactcttcctgtaaccccctctgtctcccctctctcccctctg
cacatagaaaatgcgttagtttcacccatcccagtgtccctcataccttccccctcaccc
atgctgggtaagatgggacccacatccccacagcaccagcccaccactgctctgcagcag
agtgttagaagtgaagcctctcattcacaacctgcatttatatctgcactaaccacccat
cccatacacacacacatttcactgtcccaaaacacacaccctcccacaaatggcagcact
cagcctctgatacagcaggctccccagcaggcccagatcagccaccctgagcttgtcccc
tctgctcagccagtccagcctacactattctcctcacctatgcagaatgggcctgaccca
ggcacagtcaccactgctgcccatctggacaacaataaccaatgccagctggccctgcag
gcccaggcccagagtcagcttcagagccaaattcctgtgctgcagacctctgagtctcag
agagcatcatcggggtctgccagttccagtctgactcagcagaaacatctcactactcta
acaggagctgcaggtccaggtccaacagacaccagcacggaggatccagcttcagagaag
cacagtgcagggcagagctatgacagtgtcaactctgatgccacgtcagggaaggagatg
agtgatggttgtgaggggacacaaggaagtaaaggcgaaggcaaagtccgcaaacaccac
cgcaggtccacacgcactcgctctcgtcaagagaagattagcagaccaaagctcagcatg
ctcaatgtgtgtaacactggggataagatggtagagtgtcagttggaaactcataaccat
aagatggtcactttcaagtttgatctggacggagatgcaccagaggagattgctatatac
atggtggagaatgatttcattttacctctggagaaagacgtcttcattgaacagctgaag
gacattgtggacaaagctgaggacatgctgagtgaggacaccgagggtgagaggaactct
gaccagggaggcagtcccaaacagagtgaaggagctgacacgctgggaacagaggcttca
gcacccagcaccccacagctggtgtaccaacaaaatgtcctccacactggcaaacgctgg
tttatcatctgccctgtagctgagacgcccatggtagacaaagagaagactacatcacac
acctctacagcccaggaatctgaaaagtctgcttcatcatcagtcaggcccaacagcaac
acaactgcaatgactaccccagtcgcatctttatcatcgcaaagccaatcctcctcctcc
tctctgccctctgctgctcagacctcggtgcaacctccaggccaaaaccttggcaaagcc
cgtgtccagcagactcagccaagtgtaactaaacatgcccatgctgctgctggtgtgagc
catcaaaactcccttcctgtggaagaaccttgcatctctgctgtctctatggtgacggac
atgccatgctgtgctattgtgccacctgtctctctcgatgtgaatgccaatgataaagga
gcagttggtagtttggtctcgtctcaaaccaatcagcccaatgagaaggccagtcctact
ggagaactaccccctcagctgggctctcatcagtctgtggtcctgcagcaaccctatgcc
acatccatgcaacctgggacagttacctcccagccccagagtccagcacatcagacctcc
cagaactcccagttgtcaagccaccagcagccagcaggcggaggaccaggagagtcggac
agtgagggaccacgcagggtggagtttgttgaccgcaccatcaagactctggatgagaag
ctgagaaacctgttgtaccaggagcatgctccctcccagccttcaagcacgacatctgac
ccccaggcgtccagtgcagagggagtcagctctcctccagtctcagatggccagagcact
gagggagcacttacaaagaagaagggcgacccactgcctcagattcctgagcgcacagag
agtgtgggtgcactaagtgattctgcagtggcagcggcgagcagggctttgaaaggaaga
gatgtgactgccagctccagttcatacagctccaaaaaccgttttcaaatcatccctact
ccaccagatgtcatttgtcgtttagagaaaagcaagacaagctacagcacctgcagttct
gcagcaccctctagtggctcaggagggtctcacagccagatccagggcgcaggcagtaaa
gagaagggcagtgtggctgtgggcaggtcttccgtgacggcagctgaagatgagaatgca
gcaatatccaaaacccttagttgtaaccgctactccgcccctccaaacttcttccatgcc
acacccacttccagccctgatgtcaccccacgccatatcccccgagcccagaccattgac
actccgacccatcactactaccaccactcctctcacctctgttctgactcagcagatgag
gatagcagcagcatagctctccctccggcccacccagctcccccacctcatgccctgtct
gagcacagtggtagcgacctcatgaagagggcagtggccttcctgcggcgctctggtcgg
agcaaaagtgagcagagctctgattcaccaagccgacagcctgtggcaatgaatggtcac
gctccagcgcctgctgcaggacatgcccactcatcctacatcagtagtgacaatgactct
gagtttgaggatgctgatatgaagaaggagctacaaaaactgagagaaaaacacatgaag
gagatctctgagctgcaggcgttccagaggagtgagattgagcgtctgtacaaagagctg
ggcaaaactctgccccccaacgtcggcctacttcatgcggcacccccaagtggccgcagg
cgtagggccagcaaacacaagctcaaggctggaaaactgctcaatccgatggtgcagcaa
cttaaaaacaaccttaacaccaccactgagaggaaaggtgaaagtgctgccagttcatcc
ggctctcctgctaaaagttcaattctgtcagatggctctgcccactccagtggcagctcc
agctccgctaatcagcccaattcagccccagagcaggtccacacacagcaaccctgttcc
ttgaagggctctttctcctcagacaacatctactctggcctacacagtgatggaatggct
acccaagcaggccctggccaaggctggacggtttaccaccaaacgtcagagagagtcacc
tataaatctagtagcaaaccacgcactagattcctcagtggacctgtgtctctgtccatc
tggtccactctgaaacgactatgtctaggcaaagagcgcagtagtaggtcctctctcaat
accaccactgctcagacagcctccagtcagacacagccgcaactcaccacagccacaccc
tcaccatctcctcagccaatcacccggcttgctcaggtccagaccaacaacagcaacaac
aagagaggcacattcaccgatgatcttcacaagctggtagatgactggacgaaggagact
gttgctgcagccaatcaaccaagaccttccctgaaccagatcaaacagcagagacgccag
cgggacctggaatgcagagcaccacccatgggagcagctacacgagaggtgaaatgccat
gttggtcccagcaagttccagctgcctctttcctgccccctgactgctgctttaggccct
ggtatgcctacaagcctagctcccagctcctcagcaatgctccctcctgggtaccttctg
ccaccaggctcctatggtgggatggttcccggtcctctttaccctcagcagtggcccggt
atgcctagtcctgtagggtccgtgggtcctgtaggcctgcttggtgctgcaagaatgatg
ccctatgccacaatggcaaacccagggatccaagccttccctctggtcatgcacaagccc
gagaatggcccctgtccgaaaaccactaggactacctaa

DBGET integrated database retrieval system