KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111672358Help
Entry
111672358         CDS       T06058                                 

Definition
(RefSeq) arylamine N-acetyltransferase, pineal gland isozyme NAT-10-like
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal00232  Caffeine metabolism
slal00983  Drug metabolism - other enzymes
slal01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    111672358
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    111672358
Enzymes [BR:slal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     111672358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-GeneID: 111672358
NCBI-ProteinID: XP_023285542
Position
Unknown
AA seq 193 aa AA seqDB search
MDGQYRVAECKMNLEEYFKRIGFHGSNEKLDLATLKLIHKQHVMSIPFENLSIHCGEKII
MDLEVIFNKIVRSSRGGWCLENNFLFGWVLRIYGFTLVPRDADHFFETSHTLQTDPSSLF
TNKSICSLQTPAGFRALIGWTYSEVTYKPVEGVDVLDMRDIPDDEIEQILKEKFSVKLPN
KLKPINNKAWYTL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggatgggcagtaccgagtggctgagtgcaagatgaatttggaggagtacttcaaaaga
attggtttccatggctctaatgaaaaactggatcttgcaacactgaaactgatccacaaa
caacatgtcatgtcaattccatttgaaaacctcagcattcactgtggtgagaagatcatc
atggacctggaggtcattttcaataagatagtgaggagcagtcgtggaggctggtgcctt
gagaacaactttctttttggctgggtgctgagaatctacggcttcaccttggtgcctcgt
gacgcagatcatttctttgagacaagccacacacttcagacagatcctagttcactgttc
accaataagtccatctgctctttgcaaacacctgcaggattcagagccctgatcggctgg
acctacagtgaggtcacctacaaacctgtggaaggtgttgatgttttagacatgagggac
ataccagatgatgagatagagcaaattctgaaggaaaagttcagtgtaaagttgccgaac
aagctaaagcctataaacaacaaagcgtggtacacactctga

DBGET integrated database retrieval system