KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111672667Help
Entry
111672667         CDS       T06058                                 

Definition
(RefSeq) leukotriene B4 receptor 1-like
  KO
K04296  leukotriene B4 receptor 1
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Pathway
slal04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:slal00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    111672667
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:slal04030]
    111672667
G protein-coupled receptors [BR:slal04030]
 Rhodopsin family
  Lipid
   Leukotriene
    111672667
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx DUF3278
Motif
Other DBs
NCBI-GeneID: 111672667
NCBI-ProteinID: XP_023285938
Position
Unknown
AA seq 306 aa AA seqDB search
MEQLNSTEATSNNSSSPGPSPLVSSDSSTLAPVVVLSFCFLVGVPGNIAVIILKPNWQHL
SSLSQNLMLNLAISDMLCLLPLPLWIYSFLYNWIFGLVACKLLAYLVYCCLYSSVLTVTV
LSIQRYLQVAYLHKSLHDVGNKRLLVLLWLVAMIFSIPALLVRQPIEEKHMTLCQAKYSS
NAQWLAVLLSESLVGLVSFSVVAFAYICLHRKVNQTAFFNHPKTTRLITSIIVTLFTLWM
PHHIINLLGVAAISVKNKGLLSFCMDSWNIVGALTFVNSCLNPLLYAFASRNMCTVCQKP
EHKYCC
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggaacaactcaactccactgaggccacatctaacaactcctcctctcctggaccgtca
cctctcgtctcctcggactccagcactctggctcctgtggtggtgctgtctttctgcttc
ctggtgggagttcctggaaacatcgctgtgatcatcctcaaaccaaactggcagcacttg
tctagtctgagccaaaatttgatgctgaatctggctatatcagacatgctctgcctgctg
cccctgcccctgtggatttattctttcctctacaactggatcttcggactggtggcctgt
aagcttctagcgtacctcgtgtactgctgcctttacagcagcgtgctgactgtgacggtg
ctgagcatccagaggtacctgcaggtggcctacctacataagagtttacatgatgtagga
aacaagaggctgctggttctgctctggctggttgcgatgatcttctccatccctgcgtta
ctggttcgacagccaatcgaagagaagcacatgacactctgccaagctaagtactcttcc
aatgcccagtggttggctgtgctgctgtcagagtccctggtgggattagtttcattttct
gtagtggcatttgcatacatctgcctccacagaaaggtgaaccagacagcttttttcaac
cacccaaagacgaccagactgataaccagtatcatcgtgacccttttcaccctatggatg
ccacatcatatcataaatttgttgggtgtggcagctatttctgtcaagaacaagggtctg
ttgagcttttgtatggacagctggaacattgttggagcgctgacatttgtgaatagctgc
ctgaatcctcttctgtacgcatttgcttctcgcaacatgtgcactgtgtgccaaaaacct
gaacataaatactgttgttaa

DBGET integrated database retrieval system