KEGG   Seriola lalandi dorsalis (Yellowtail amberjack): 111673487
Entry
111673487         CDS       T06058                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) B-like
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
slal  Seriola lalandi dorsalis (Yellowtail amberjack)
Brite
KEGG Orthology (KO) [BR:slal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    111673487
Enzymes [BR:slal01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     111673487
SSDB
Motif
Pfam: AstE_AspA PDT RRM_1
Other DBs
NCBI-GeneID: 111673487
NCBI-ProteinID: XP_023287015
Position
Unknown
AA seq 337 aa
MEVDEVVCLPRLSRVAVCGGTHGNELSGVYLVRELLKAEKKVRKKEEEEEEPLSVQMVLS
NPRAMQQCRRYIDTDLNRCFTHATLNGSTSDSDPYEIIRSRELNAMLGPKGSPKAVDLVC
DLHNTTANMGLCLIAYSDCDWICLHIFRHLQRQMPDIPMRYIHFDVSSKESYSLDSVGKH
GFAMEIGPQPHGVVRSNIYTAMKVGVQHVLDWVHFFNSGTIFEGGFVDVFTMVKHIDYPR
DSETRNITAAIHPQLQDRDFCLLHPEDALFQTFSGETLRYKGNEPLYPFFVNECAYYEKG
IALSLARKRHVMIPAIRVQTEQEQQANEQGFASEEEE
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggaagtagacgaggtggtgtgtttaccgaggttgtcccgggtcgctgtgtgcggtggt
acccatggcaacgagttgtctggggtgtacttggtgagagagctgctgaaggcggagaag
aaagtgaggaaaaaagaggaggaggaagaggagcctctgtcggtgcagatggtgctgtcg
aacccacgggccatgcagcaatgccgcagatacatcgacaccgacctgaaccgctgcttc
acccacgccaccctcaatggttccacgtcagactcggacccctacgagataatcaggtct
cgagaactgaatgcgatgctgggtcccaaaggcagtcctaaggcggtggatcttgtttgc
gacctccataacaccactgccaacatgggcctgtgcctcattgcgtactctgactgtgac
tggatctgcctgcacatattcagacaccttcagaggcagatgccagatataccaatgagg
tacatccatttcgatgtctccagtaaagaatcatattcccttgattcagtgggaaaacat
ggctttgccatggagatcggccctcagccccacggtgtggtgaggtcaaacatctatacg
gcgatgaaagttggtgtgcagcatgtgctcgattgggtccatttcttcaactcaggtact
atttttgaaggaggatttgtggatgtgttcaccatggttaaacacattgactacccaaga
gacagcgagactcgcaacatcacggcagccattcatcctcaactccaggaccgagacttc
tgcctgctccaccctgaggatgcgctgttccagactttctcaggtgaaacactgaggtat
aaaggcaatgaaccactttatcctttctttgtcaatgaatgtgcatattacgagaagggc
atcgctctctccctggcgagaaagaggcatgtgatgattcctgcaatccgggtgcagaca
gagcaggagcaacaagctaacgaacagggatttgcatcagaagaagaggagtga

DBGET integrated database retrieval system