KEGG   Streptomyces laurentii: SLA_1405Help
Entry
SLA_1405          CDS       T05205                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
slau  Streptomyces laurentii
Pathway
slau00860  Porphyrin and chlorophyll metabolism
slau01100  Metabolic pathways
Module
slau_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:slau00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SLA_1405
Enzymes [BR:slau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     SLA_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase SNO Peptidase_S51
Motif
Other DBs
NCBI-ProteinID: BAU82344
UniProt: A0A160NWA3
Position
1489657..1491162
Genome map
AA seq 501 aa AA seqDB search
MGGGLLVAGTTSDAGKSVVTAGICRWLVRQGLKVAPFKGQNMSLNSFVTREGAEIGRAQA
MQARAARVEPTALMNPVLLKPGSDRSSQVVLMGKPVGEMSARGYHGGRQKELFAPVLACL
EELRRTHDAVICEGAGSPAEINLRRTDIVNMGIARAARLPVVVVGDIDRGGVFAQFFGTT
ALLAPEDQRLVAGYLVNKFRGDVSLLEPGLAMLDGLTGRPTLGVLPYAHGLGIDEEDGLR
VSLRGAVRESVVAPPFGADVLRVAVCAVPLMSNFTDVDALAAEPGVVVRFVDRPEELADA
DLVVVPGTRGTVRALAWLRERGLAAALARRAAEGRPILGVCGGFQVLGERIEDEVESRAG
AVDGLGLLPVRVRFAREKTLARPVGEALGERVEGYEIHHGVADVRGGEPFLDGCRTGAVW
GTHWHGSLESDGFRRAFLREVAAAAGRRFVPAPDTSFDALREEQLDRLGDLIEEHADTDA
LLRLIEKGAPEGLPFVPPGAP
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggggctgctcgtcgcgggcaccacgtccgacgcgggcaagagcgtcgtcacg
gccgggatctgccggtggctggtccgtcagggcctgaaggtcgcgccgttcaagggccag
aacatgtccctgaactccttcgtgacccgggagggcgccgagatcggccgcgcccaggcc
atgcaggcgcgggccgcgcgcgtcgagccgaccgcgttgatgaacccggtgctgctgaag
cccggaagcgaccgttccagccaggtcgtcctgatgggcaagccggtcggcgagatgagc
gcccgcggctaccacggcgggcggcagaaggaactcttcgcgccggtgctcgcctgtctg
gaggagctgcggcgcacccacgacgcggtgatctgcgagggcgcgggcagcccggcggag
atcaacctgcgccgcaccgacatcgtgaacatgggcatcgcgcgggccgcgcggctgccc
gtggtcgtggtcggcgacatcgaccggggcggggtgttcgcccagttcttcgggacgacg
gcgctgctcgcgccggaggaccagcggctggtcgccggctatctggtgaacaagttccgc
ggcgacgtgtccctgctcgaaccgggcctcgcgatgctcgacggcctgaccgggcggccc
acgctcggcgtgctgccgtacgcgcacggcctcggcatcgacgaggaggacgggctgcgg
gtctcgctgcgcggcgcggtccgcgagtcggtcgtggcaccgccgttcggcgcggacgtg
ctgcgggtcgccgtgtgcgccgtcccgctgatgtcgaacttcacggacgtggacgcgctg
gcggcggagccgggtgtggtggtgcggttcgtggaccggcccgaggagctggccgacgcc
gatctggtggtcgtgccgggcacccgcggcacggtgagggcgctggcctggctgcgcgag
cgcggtctcgcggcggcgctggcccggcgggccgccgagggccgtccgatcctcggggtg
tgcggcggtttccaggtcctcggcgagcgcatcgaggacgaggtggagtcgcgggccggg
gcggtcgacgggctcggcctgctgcccgtacgggtccggttcgcgcgcgagaagacgctg
gcgcggccggtgggcgaggcgctcggcgagcgggtcgaggggtacgagatccatcacggc
gtggcggacgtacggggcggggagccgttcctggacggctgccggaccggggcggtgtgg
gggacgcactggcacggctcgctggagagcgacgggttccgccgggcgttcctgcgggag
gtcgcggcggcggccgggcgccgtttcgtcccggcgccggacacctcgttcgacgcgctg
cgcgaggaacagctggaccggctgggcgatctgatcgaggagcacgccgacacggacgcg
ctgctgcggctgatcgagaagggcgcgccggaggggctgccgttcgtgccgccgggtgcg
ccgtga

DBGET integrated database retrieval system