KEGG   Streptomyces laurentii: SLA_4112Help
Entry
SLA_4112          CDS       T05205                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
slau  Streptomyces laurentii
Pathway
slau00520  Amino sugar and nucleotide sugar metabolism
slau01100  Metabolic pathways
slau01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:slau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SLA_4112
Enzymes [BR:slau01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     SLA_4112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: BAU85000
UniProt: A0A160P3D9
Position
complement(4290686..4291837)
Genome map
AA seq 383 aa AA seqDB search
MAVSTVLAGARVVLPTGIVENGRVIVENGRIAGSVPDDATVPPLDLSGHWLVPGFVDMHN
HGGGGASFTSGTTDEILTGVRTHRLHGTTTVVASFVTGDMDFLGRRAGLLSELAEQGEIA
GIHFEGPFISPCRKGAHDETLLRDPEPAEVRKLIEAARGQARMVTLATELPGGIDSVRLL
AEHGVIAAIGHTDATYEQTVAAIDAGATVATHLYNAMPGLGHRAPGPIAALLEDERVTVE
LINDGTHLHPAALELAFRHAGPERVAFITDAMDAAGFGDGRYMLGTLEVEVKDSVARLVE
GGSIAGSTLTLDRAFKRAATIDRLPVEAIVQAISANPARLLGVYDRVGSLEPGKDADVVV
LDADFEVKGVMRKGEWLVEPELG
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttccacagttctcgccggggcccgtgtggtgctgccgaccgggatcgtcgag
aacgggcgagtgatcgtcgagaacggccgcatcgcgggcagcgtccccgacgacgccacc
gtgcccccgctcgacctctccggccactggctcgtgcccggcttcgtcgacatgcacaac
cacggcggcggcggcgcgtccttcacctccggcaccaccgacgagatcctcaccggcgtc
cgcacccaccggctgcacggcaccaccaccgtcgtcgcctccttcgtcaccggcgacatg
gacttcctcggccggcgcgcgggcctgctgtccgaactcgccgagcagggcgagatcgcc
ggcatccacttcgagggcccgttcatctccccgtgccgcaagggcgcccacgacgagacg
ctgctgcgcgaccccgagccggccgaggtgcgcaagctgatcgaggcggcgcgcggccag
gcccggatggtcacgctcgccaccgaactgcccggcggcatcgactccgtacggctgctc
gccgagcacggcgtgatcgcggccatcggccacaccgacgccacgtacgagcagaccgtg
gccgccatcgacgcgggcgccaccgtcgccacccacctctacaacgcgatgcccggcctc
gggcaccgcgcgcccggcccgatcgcggcgctcctggaggacgagcgggtcaccgtcgag
ctcatcaacgacggcacccacctgcacccggccgcgctggagctggcgttccgtcacgcg
gggccggagcgcgtcgcgttcatcaccgacgccatggacgcggcgggcttcggcgacggc
cgctacatgctcggcacgctggaggtcgaggtgaaggacagcgtggcgcggctcgtcgag
ggtggctccatcgcgggttcgacgctgaccctcgaccgggcgttcaagcgggccgcgacg
atcgaccggctgccggtcgaggcgatcgtccaggccatctccgccaacccggcgcggctg
ctcggcgtctacgaccgggtcggctcgctggagccgggaaaggacgcggacgtcgtggtg
ctcgacgcggacttcgaggtcaagggcgtgatgcgcaagggcgagtggctggtcgagccc
gaactgggctga

DBGET integrated database retrieval system