KEGG   Sugiyamaella lignohabitans: AWJ20_356Help
Entry
AWJ20_356         CDS       T05270                                 

Definition
(RefSeq) hypothetical protein
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
slb  Sugiyamaella lignohabitans
Brite
KEGG Orthology (KO) [BR:slb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:slb01009]
    AWJ20_356
Enzymes [BR:slb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     AWJ20_356
Protein phosphatases and associated proteins [BR:slb01009]
 HAD phosphatases
  Other HAD phosphatases
   AWJ20_356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6
Motif
Other DBs
NCBI-GeneID: 30035595
NCBI-ProteinID: XP_018734595
UniProt: A0A161HKD9
Position
A:complement(1133631..1134443)
Genome map
AA seq 270 aa AA seqDB search
MASTTANTSSSTSTTSSSTPAHAHIQIKACLFDMDGLLINSEDIYTEITNEILHEHGKPS
LPWEVKVQLQGRPGPDASRKLLEWAQLPYTPEEYFKMTSERQKTRWNKTTFMPGALELLQ
HLEDIKVPFALATSSHHANYLLKTKHLRHGFDLFGDHVVVGDDKRIPPGRGKPHPDIWHV
ALESLNSVQRAKNLPEIKPEECLVFEDGVPGVIAGKAAGCRVIWVPDSRALEVLDQNEVV
DLVGDHELLESLHHFDKAKYGLEKPTLTGL
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccaccgctaacaccagctcctccacgagcaccacgagctcctccacacca
gcacacgctcacatccagatcaaagcctgtctgtttgatatggacgggctcctgattaac
tctgaggatatttataccgaaatcaccaatgagattcttcacgagcacggcaaacccagt
cttccctgggaagtcaaagttcaattacaaggccgaccaggaccggatgcgtcgagaaaa
cttctcgaatgggcacaattgccatacacgcccgaggaatacttcaaaatgacgagcgag
cgacaaaagacccgttggaacaaaacaacgtttatgcccggagcattagagttgctgcag
cacctggaagatatcaaagttccgtttgcactggccacatcatcccaccatgccaattat
cttctcaagaccaaacacctgcgacacgggtttgatctgtttggcgaccacgtcgtagtc
ggcgacgacaaacgaatcccacccggtcgtggcaaaccacaccccgacatctggcacgtg
gctctcgaatcactaaattccgtgcaacgggccaaaaacctgccagaaatcaagcccgaa
gaatgtctcgttttcgaagacggtgtccctggcgtcatcgctggcaaagcagccggatgc
cgtgtgatctgggtgcccgactcacgagctctcgaagttctcgaccaaaacgaggtggtc
gacctcgttggtgaccacgaactcctcgaaagtctccaccacttcgacaaagccaaatac
gggctcgagaaaccgacgctgacgggtctgtaa

DBGET integrated database retrieval system