KEGG   Sugiyamaella lignohabitans: AWJ20_5140Help
Entry
AWJ20_5140        CDS       T05270                                 

Gene name
NIP1
Definition
(RefSeq) Nip1p
  KO
K03252  translation initiation factor 3 subunit C
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb03013  RNA transport
Brite
KEGG Orthology (KO) [BR:slb00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    AWJ20_5140 (NIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:slb03012]
    AWJ20_5140 (NIP1)
Translation factors [BR:slb03012]
 Eukaryotic type
  Initiation factors
   eIF-3
    AWJ20_5140 (NIP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: eIF-3c_N PCI
Motif
Other DBs
NCBI-GeneID: 30037350
NCBI-ProteinID: XP_018736658
UniProt: A0A167EKD9
Position
D:1641402..1644050
Genome map
AA seq 882 aa AA seqDB search
MSKFFAGSDSESSSSDEELYSSSGEEDKDVSSSEEESSEEDDSEDESSDEESDEETGGAK
KGTPGYYMRNQFLKGGSSAGADSDEESEDEGKRIVKSAKDKLVDEIDASIKAIENAKRIN
DWVAISGEFDKVNRLAERAGKQYSTTPPQYINMLMELDEFAQEAVKNEKQAKKKMNASNS
RALNTIKQRIKKTSKGFETKIAAYKSDPELYQRELKGETTPQPEATASFKKTTVASTTST
TVAAADDNDGFSTVGKAGKVLQYTPENIFKTLISIVESRGKKNTDRAEQIKTLEELNKVA
TTPYQKISVLLMLIPIRFDLTSAGSVVPTQNWKAAEQDIRALFTVLEENASTYRVSESAS
EPEDIEEGPTAGPDGVKEIPGSVTSLIERLDDEFTRALQNIDPHTTEYVDRLRDEADLYT
LIIRGQLYLESSLKQGQQPHTSEALSRLLVRRLDHIYYKPTSVIINSERDAWDKIRSADV
TSKQLITPRISGDVAVTDKSYTIQLIDRICSVLYQQQSTIFRSKAMLSHIYHYALNDYYF
KARDLFLMSHLQSSIHTADPTIQVLYNRALVQVGLCAFRIGLIVECQQSLQEICSSSRLK
ELLGQGVTKFGQVSAPDKQRLLPFHMHINLELLECVYLTASLLIEIPLMASLGNSIDAKK
KIVSKPFRRMLDYHDRQVFSGPAENTRDHIMQAGKALLNGDWTSSRDLLTSIKIWSLLSN
AEEIKTMLGVKVQEEGLRTYIFNYGSCYQSLSISILSSLFELSERKVSAIVSKMIATEEI
AAALDQKSNSIVFRKGVELSNLQVLAQALADKSVQLAERNERLAAGGHQLSEQGNTSGPN
KPSGQSGQGDRYNNDRSSNQRGQNRQGNSGRRENQQPRPIRA
NT seq 2649 nt NT seq  +upstreamnt  +downstreamnt
atgtccaagttttttgctggttctgatagtgagagctcgtcttcggacgaagaactgtac
tcgtcctctggagaggaggataaggacgtttcttccagtgaagaagaatcttctgaagaa
gacgactctgaagatgagtcgagtgatgaagaatccgacgaggaaactggaggtgctaaa
aaaggtactcccggttattacatgagaaatcaattcttgaaaggaggttcttcggctggt
gctgattccgacgaagagtcggaggatgagggcaaaagaattgtcaaatctgctaaagac
aagcttgttgatgagattgatgcttcgatcaaagccattgagaatgccaagagaatcaac
gattgggtggctatttctggagaattcgacaaggtcaaccgtctggccgagcgtgctggt
aagcaatacagtaccactcctcctcagtatatcaatatgttaatggaattggacgagttt
gctcaagaggctgttaagaacgagaaacaggctaaaaagaagatgaatgcatccaacagc
agagccttgaacaccatcaagcaacgtatcaagaagacctctaagggctttgagactaag
attgctgcttataagagtgatcccgaactttatcaacgtgagttgaagggtgagactact
cctcaacccgaggctactgcctctttcaaaaagaccactgttgcctcgaccactagcacc
actgtggctgctgctgatgataacgacggattctccaccgttggtaaggccggcaaggtg
cttcaatacactcctgaaaacattttcaagactcttatttccattgtcgagtctcgtggt
aagaagaatactgatcgtgctgagcagatcaagactcttgaggaactcaacaaggtggcc
accacaccttaccaaaagatttctgttcttcttatgttgattcctattagattcgatctt
acttctgctggttcggtcgttcctactcaaaactggaaggctgccgaacaagatattcgc
gctcttttcactgttctagaggagaatgcttctacataccgagtcagcgagtctgctagc
gagcctgaagacattgaggaaggacccactgctggtcctgacggagtcaaagagattcct
ggtagtgtcacatctcttattgagcgtttggatgacgagttcactcgtgctcttcaaaac
atcgatcctcacacaaccgaatatgttgatagattacgtgacgaggctgatctgtacaca
ctgattattcgtggccagttgtacttggaatccagcctaaaacaaggtcaacaacctcat
acatccgaggctcttagccgacttttagtgcgaaggctcgatcacatctactataaaccc
acttcagttattatcaattctgagcgtgacgcctgggacaagatccgtagtgccgatgtc
acctctaaacaactcattactcctagaatctctggtgatgttgctgttactgataagagc
tacactatccaacttatcgatagaatctgttctgtcctctaccaacaacaaagcactatt
ttcagatccaaggctatgttgagtcatatctaccactatgctttgaacgactactatttc
aaggcccgtgacttgtttttgatgtcgcatttacaatcttccatccacactgctgacccc
accatccaagtcctctataacagagctcttgtacaggttggtttgtgtgcctttagaatc
ggtttgattgtcgagtgtcaacaatcattacaagagatctgctcttcgtcccgtctcaag
gagcttcttggccaaggtgtcaccaagttcggtcaagtcagtgctcctgataagcagaga
ttactgcccttccacatgcacatcaatctcgagttgttggagtgtgtctacctgactgcc
tctcttctcatcgagatcccactcatggcctctctcggcaactctatcgatgccaagaag
aagattgtatccaagccattccgtagaatgctcgactaccatgacagacaagttttcagc
ggacctgctgaaaacacccgtgatcacattatgcaagctggtaaggccctgttgaacggt
gactggaccagttctcgtgacttgctgacctcgatcaaaatctggtctttgctcagcaat
gccgaagaaatcaagaccatgcttggcgtcaaggtccaagaagagggtctcagaacatac
attttcaactacggctcgtgttaccagtcactgtcgatttccatactgtcatcgctgttt
gagctttccgagcgcaaggtgtctgctattgtgtccaagatgattgctactgaggagatc
gctgctgctcttgatcaaaagtccaactcgattgttttcagaaagggtgttgagctctcc
aacttgcaagttcttgcccaagctcttgccgacaagtccgtgcaactggcggaaagaaac
gagagactcgctgccggtggccaccagctgtctgagcaaggcaacaccagcgggccaaac
aagccctcgggacaatctggccagggcgaccgttacaacaacgaccgttcgtctaaccaa
agaggccaaaacagacagggtaatagcggtcgtcgtgagaaccagcagcccagacccatc
cgcgcttaa

DBGET integrated database retrieval system