KEGG   Sugiyamaella lignohabitans: AWJ20_681Help
Entry
AWJ20_681         CDS       T05270                                 

Gene name
LSC2
Definition
(RefSeq) succinate--CoA ligase (GDP-forming) subunit beta
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
slb  Sugiyamaella lignohabitans
Pathway
slb00020  Citrate cycle (TCA cycle)
slb00640  Propanoate metabolism
slb01100  Metabolic pathways
slb01110  Biosynthesis of secondary metabolites
slb01130  Biosynthesis of antibiotics
slb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AWJ20_681 (LSC2)
   00640 Propanoate metabolism
    AWJ20_681 (LSC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:slb04147]
    AWJ20_681 (LSC2)
Enzymes [BR:slb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AWJ20_681 (LSC2)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AWJ20_681 (LSC2)
Exosome [BR:slb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AWJ20_681 (LSC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A Cytochrome_P460
Motif
Other DBs
NCBI-GeneID: 30037740
NCBI-ProteinID: XP_018734905
UniProt: A0A161HKS2
Position
A:2163985..2165289
Genome map
AA seq 434 aa AA seqDB search
MFNATVRRAVARAGRPVAVPKRNLSLHEYRSAQILKDYGIAVPRGAASTTAEGAEKIAKD
LGLEDMVIKAQVLAGGRGKGTFDSGLKGGVKLISSPYEAKMYAEQMLGHKLITKQTGAAG
KEVTAVYVVEREFVRREAYLAVLMDRATQGPVIVASSQGGMDIEGVAKETPDAIHSFKVD
IHEGVTDELALKVANSLGFSAKAVPEAAETVKKLYKVFKEKDATQIEINPLSETVENKVL
AMDAKLGFDDNASFRQEEVWGWRDFTQEDPDEVEASKSNLNFIKLDGNIGCLVNGAGLAM
ATMDIIKLYGGDPANFLDCGGGATAKAIEKAFELITSESKVTAIFVNIFGGIVRCDNIAK
GLIATTQNMSLNIPIVVRLQGTNLEEAQRLISESGLKIFSFTDLDEAAQKVCQLSKVVQM
ARDIDVNVSFELPL
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgtttaacgctacagttcgtcgggcagtggcccgggctggccgtcccgtggctgtgcct
aagagaaacctctcattacacgagtaccgttcggcccagattttgaaggattacggcatt
gctgttcctagaggagcagcctcgactactgccgagggtgctgagaagattgctaaggat
ttgggtcttgaggatatggttattaaggctcaggttcttgctggtggtagaggtaaaggt
actttcgacagtggtttaaagggaggtgtcaagttgatttcttctccttatgaggccaag
atgtatgctgagcagatgctcggtcacaagcttattaccaagcaaactggtgctgctggt
aaagaagtcactgctgtttatgtcgttgaacgtgagtttgttcgtagagaagcttatctc
gctgttcttatggacagagctactcaaggacctgttattgtcgcctcttctcaaggtggt
atggatattgagggtgttgctaaggagactcctgatgctattcattccttcaaggtcgat
atccacgagggagttactgacgaattggctttaaaggttgctaattcgcttggattctct
gccaaggctgttcctgaggctgctgagactgttaagaagctttataaggtgttcaaggag
aaggatgccactcaaatcgagatcaaccctctttccgagactgttgagaacaaggttttg
gctatggatgccaagcttggttttgatgacaatgcctctttccgtcaagaggaggtttgg
ggatggagagatttcactcaagaagatcctgatgaggtcgaggcttcgaagtctaacttg
aactttatcaagctcgatggtaacattggatgtcttgttaatggtgctggtcttgctatg
gccactatggatattatcaagctctatggaggagacccagctaactttttggactgtggt
ggtggtgctactgccaaggctattgagaaggctttcgagctcattacctctgagtctaag
gtcactgctatcttcgtcaacattttcggtggtatcgtgagatgtgacaacatcgccaag
ggtctgattgccaccacccagaacatgagtctcaacatccccatcgtggtccgtctgcaa
ggaaccaacctcgaggaggcccaacgtctgatctccgagtccggtctcaagatcttctcg
ttcaccgacctcgacgaggctgctcaaaaggtctgtcaactgtccaaggtcgtccaaatg
gcccgtgacatcgacgtcaacgtctcctttgaactccccttgtaa

DBGET integrated database retrieval system