KEGG   Streptomyces lydicus 103: SL103_00445Help
Entry
SL103_00445       CDS       T04699                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00450  Selenocompound metabolism
slc00970  Aminoacyl-tRNA biosynthesis
slc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SL103_00445
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SL103_00445
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:slc01007]
    SL103_00445
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:slc03016]
    SL103_00445
Enzymes [BR:slc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SL103_00445
Amino acid related enzymes [BR:slc01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SL103_00445
Transfer RNA biogenesis [BR:slc03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SL103_00445
 Prokaryotic type
   Other AARSs
    SL103_00445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AOP44925
UniProt: A0A1D7VDT9
Position
complement(104789..106504)
Genome map
AA seq 571 aa AA seqDB search
MARHLITSALPYINGIKHLGNMVGSMLPADVYARYLRQRGHDVLYICATDEHGTPAELAA
KDAGQSVDAFCAEQHDKQKAIYEGFSLEFDYFGRSSSPENVELTQHFARKLHENGFIEER
AIRQVFSVADDRFLPDRYIVGTCPHCGYDKARGDQCENCTRVLDPTDLIDARSAISGSGD
LEVRETKHLFLLQSKLQHEVEGWLEGNGSKEWPTLASSIAHKWLTEGLQDRAITRDLDWG
VPVPADVWPELAAEGKVFYVWFDAPIEYIGATKEWADVDPQNRDWKAWWYEAENVRYTEF
MAKDNVPFHSVMFPATQLGTREPWKKVDFLKAFNWLNYYGGKFSTSQRRGIFTDAALELL
PADYWRYFLIANAPESDDTSFTWELFSSSVNKDLADTLGNFVNRVLSFSRKRFGDDVPAG
AEAGAAEQKLGEEIAGLLAEYEGHMEALQFRKAAASLRALWSAGNSYLEEKAPWLEIKTD
KDAAALTLRTAMNLIHLYAVVSEPFIPTSAKAMRSAFALENDTAPWVSQDEAKALASVPA
GTPFTVPPVLFAKITEEDLESYRERFGGAEQ
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atggctcgacacctcatcaccagcgcccttccgtacatcaacgggatcaagcacctgggc
aacatggtggggtccatgctcccggccgatgtctacgcccggtacctgcggcagcgcggg
cacgacgtgctctacatctgcgcgacggacgagcacgggaccccggcggagctggcggcg
aaggacgccgggcagtcggtcgacgcgttctgtgcggagcagcacgacaagcagaaggcc
atctacgagggcttcagcctcgaattcgactacttcggccgcagctcctcgccggagaac
gtcgagctcacccagcacttcgcgcgcaagctgcacgagaacggcttcatcgaggagcgg
gcgatccgccaggtgttctcggtcgccgacgaccgcttcctgccggaccgctacatcgtc
ggcacctgcccgcactgcggctacgacaaggcgcgcggcgaccagtgcgagaactgcacc
cgggtgctggacccgaccgatctgatcgacgcccgctcggcgatcagcggcagcggcgac
ctggaggtgcgggagaccaagcacctgttcctgctccagtcgaagctccagcacgaggtc
gagggctggctggagggcaacggcagcaaggagtggccgaccctggcgtcctccatcgcg
cacaagtggctgaccgaggggctgcaggaccgggcgatcacccgtgacctggactggggc
gtcccggtgccggccgacgtgtggccggagctggcggccgagggcaaggtcttctacgtg
tggttcgacgccccgatcgagtacatcggtgcgacgaaggagtgggccgacgtcgacccg
cagaaccgcgactggaaggcgtggtggtacgaggccgagaacgtccgctacacggagttc
atggccaaggacaacgtcccgttccactccgtgatgttcccggccacccagctggggacc
cgtgagccgtggaagaaggtcgacttcctcaaggcgttcaactggctgaactactacggc
ggcaagttctccacctcgcagcggcgcggcatcttcacggacgcggcgctggagctgctg
ccggccgactactggcgctacttcctgatcgccaacgccccggagtcggacgacacctcc
ttcacctgggagctgttctcctcctcggtcaacaaggacctggcggacaccctcggcaac
ttcgtcaaccgggtgctgtcgttctcgcggaagcggttcggcgacgacgtgcccgcgggc
gccgaggccggggccgcggagcagaagctgggcgaggagatcgccggactgctggcggag
tacgagggccacatggaggccctgcagttccgcaaggcggcggcctcgctgcgcgccctg
tggagcgcgggcaactcctacctggaggagaaggccccctggctggagatcaagaccgac
aaggacgcggcggcgctgaccctgcgcacggccatgaacctcatccacctctacgcggtg
gtctccgagccgttcatcccgacgtcggcgaaggcgatgcggagcgcgttcgcgctggag
aacgacaccgcgccgtgggtctcgcaggacgaggcgaaggcgctcgcctcggtgccggcc
ggtacgcccttcacggtcccgccggtgctcttcgcgaagatcaccgaggaggacctggag
tcctaccgcgagcgcttcggcggcgccgagcagtag

DBGET integrated database retrieval system