KEGG   Streptomyces lydicus 103: SL103_02975Help
Entry
SL103_02975       CDS       T04699                                 

Definition
(GenBank) sugar dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00030  Pentose phosphate pathway
slc01100  Metabolic pathways
slc01120  Microbial metabolism in diverse environments
slc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SL103_02975
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     SL103_02975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR DUF1776 NRDE-2
Motif
Other DBs
NCBI-ProteinID: AOP50947
UniProt: A0A1D7VW25
Position
666435..667229
Genome map
AA seq 264 aa AA seqDB search
MLQGQKALVTGANSGIGKATAIGLGRAGADVVVNYVAGRAEAEQVVEEISGFGVRAAAYE
ADVSQEDQVAAMIERMVAEFGTIDILVANAGLQRDAPFTEMTVAQWQKVLDVNLTGQFLC
AREATKEFLRRGVVPEVSRAAGKIICMSSVHQLIPWAGHVNYAASKGGVQMMMTTLAQEL
APHRIRVNAIAPGAIRTPINRSAWDTPDAEKGLLQLIPYGRVGDPEDIAHAAVGLASDLM
DYVVGTTLYVDGGMTLFPGFAAGG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
ctgctgcaaggccagaaggcactcgtcaccggcgcgaactccggcatcggcaaggcgacg
gccatcggtctgggacgcgccggagccgacgtggtcgtgaactacgtcgccgggcgcgcg
gaggccgagcaggtggtcgaggagatctccgggttcggcgtgcgcgcggcggcgtacgag
gccgatgtgtcccaggaggaccaggtcgccgcgatgatcgagcggatggtggcggagttc
gggaccatcgacatcctcgtggccaacgccgggctgcagcgcgacgccccgttcaccgag
atgacggtggcccagtggcagaaggtgctggacgtcaacctcaccggtcagttcctctgc
gctcgggaggcgaccaaggaattcctgcggcgaggggtcgtccccgaggtgtcgcgggcc
gcggggaagatcatctgcatgagctcggtgcaccagctcatcccctgggccggtcacgtc
aactacgcggcctccaaaggcggcgtgcagatgatgatgacgacgctcgcccaggagctc
gcaccccacaggatcagggtcaacgccatcgctccgggagccatcagaacgcccatcaac
cgcagcgcctgggacactcccgacgcggagaagggcctgttgcagctgattccctacggg
cgggtcggtgaccccgaggacatcgcccacgcggccgtcgggctcgcgtcggacctcatg
gactacgtggtgggcaccactctctacgtggacggcggcatgaccctcttccccggtttc
gccgccggcggctga

DBGET integrated database retrieval system