KEGG   Streptomyces lydicus 103: SL103_03630Help
Entry
SL103_03630       CDS       T04699                                 

Definition
(GenBank) trans-aconitate methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
slc  Streptomyces lydicus 103
Brite
KEGG Orthology (KO) [BR:slc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SL103_03630
Enzymes [BR:slc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     SL103_03630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS PCMT UPF0020 Ubie_methyltran Methyltransf_32 CMAS
Motif
Other DBs
NCBI-ProteinID: AOP45451
UniProt: A0A1D7VFG6
Position
826536..827357
Genome map
AA seq 273 aa AA seqDB search
MHDAPTWDPQQYLRHSGHRTRPFHDLLARISELPRQDRPARIADLGCGPGNVTALLAARW
PDAHITGYDNSPEMLKEAENHAGPTPGGGHLDFAPADAADWAPEEPYDLIVSNAALQWVP
NHPESFARWIDALTPGGTFAFQVPGNFTSPSHALLGELCDSPQWRERLTTHGRRYVHVLE
PAAYLERLTDLGCAADVWETTYVQLLQGDDPVLDWVKGTALRPVLTALENDQAALDAFLA
EYRDALRKAYPTGPHGTVFPFRRIFALARKPLG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcacgacgcgccaacctgggacccgcagcagtacctccgccactccgggcaccgcacc
cgccccttccacgacctgctcgcccggatatccgagctcccgcggcaggaccgccccgcc
cgcatcgccgacctcggctgcggcccgggcaacgtcaccgccctgctcgccgcccgttgg
cccgacgcgcacatcaccggatacgacaactccccggagatgctcaaggaagccgagaac
cacgccggccccacccccggcggcggacacctcgacttcgcgcccgccgacgccgcggac
tgggcgcccgaggagccgtacgacctgatcgtctccaacgcggcgctgcaatgggtcccc
aaccacccggaatccttcgcccgctggatcgacgccctcacccccggcggcaccttcgcc
ttccaggtccccggcaacttcacctcaccgagccacgccctgctcggcgagctgtgcgac
tccccccagtggcgcgagcgcctcaccacccacggccgccgctacgtccacgtcctcgaa
ccggccgcctacctggagcgcctcaccgacctcggctgcgccgccgatgtctgggagacc
acctacgtccagctcctccagggcgacgacccggtcctcgactgggtcaagggcaccgcc
ctgcgccccgtcctgaccgccctcgaaaacgatcaggccgccctggacgcgttcctcgcc
gaataccgcgacgccctccgcaaggcataccccaccggcccccacggcaccgtcttcccc
ttccgccgcatcttcgccctcgcccggaaacccctcggctga

DBGET integrated database retrieval system