KEGG   Streptomyces lydicus 103: SL103_12675Help
Entry
SL103_12675       CDS       T04699                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00260  Glycine, serine and threonine metabolism
slc01100  Metabolic pathways
slc01110  Biosynthesis of secondary metabolites
slc01120  Microbial metabolism in diverse environments
slc01130  Biosynthesis of antibiotics
slc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SL103_12675
Enzymes [BR:slc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     SL103_12675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_5 Aminotran_1_2 Glyco_hydro_20 Inhibitor_I48
Motif
Other DBs
NCBI-ProteinID: AOP46994
UniProt: A0A1D7VJQ2
Position
2956936..2958021
Genome map
AA seq 361 aa AA seqDB search
MADPRAVSGATTDARQHHDPGTRGFASDNYAGAHPEVLAALALANGGHQVAYGEDDYTAH
LQRVFRSHFGQRAEAFPVFNGTGANVVALQAVTDRWGAVIAAETAHINVDECGAPERVGG
LKLLTVPTEDGKLTPELIDRQAWGWDDEHRAMPQVVSITQSTELGTVYTPDEVRAICDHA
HERGMVVHLDGSRIANAAATLDVPMRAFTNAVGVDILSYGGTKNGAVFGEAVVVLNPDRV
RAMKHLRKLSMQLASKMRFVSVQLEALLAKDLWLRNARHANTMAQRLAAGVRQIDGVQIL
YPVQSNAVFARLPHDVSERLQKRYRFYFWDEQAGDVRWMCAFDTREEDVDGFLAALREEL
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggctgacccccgagccgtgagcggagcgacgaccgacgcacggcagcaccacgatccc
gggacccgcggcttcgccagcgacaactacgccggcgcccacccggaggtcctggccgcg
ctcgccctcgccaacggcggccaccaggtcgcctacggcgaggacgactacaccgcgcac
ctccagcgcgtcttccgcagccacttcgggcagcgcgccgaggcgttcccggtcttcaac
ggcacgggcgccaacgtcgtcgccctgcaggccgtgacggaccgctggggagcggtgatc
gccgccgaaaccgcacacatcaacgtcgatgagtgcggtgcgcccgagcgggtcggcggt
ctcaagctgctgaccgtaccgaccgaggacggcaagctcacccccgagctgatcgaccgc
caggcgtggggctgggacgacgagcaccgcgccatgccgcaggtcgtctcgatcacccag
agcaccgagctgggcacggtctacacgcccgacgaggtccgggcgatctgcgaccacgcg
catgagcgcggcatggtggtccacctggacggctcgcggatagccaacgccgcggcgacc
ctcgacgtcccgatgcgggccttcaccaacgccgtgggcgtcgacatcctctcctacggc
ggcacgaagaacggcgcggtcttcggcgaggccgtggtcgtgctcaaccccgaccgggtg
cgcgcgatgaagcacctgcggaagctgtccatgcagctcgcctccaagatgcgcttcgtc
tccgtccagttggaggcgctgctcgccaaggacctgtggctgcgcaacgcccgccacgcc
aacaccatggcccagcggctggcggccggcgtacggcagatcgacggggtccagatcctc
taccccgtccagtccaacgcggtcttcgcccgcctcccgcacgacgtgagcgaacgcctc
cagaagcgctaccgcttctacttctgggacgagcaggccggcgacgtccgctggatgtgc
gcgttcgacacccgcgaggaggacgtcgacggcttcctcgcggcgcttcgcgaggagctg
cgctga

DBGET integrated database retrieval system