KEGG   Streptomyces lydicus 103: SL103_14160Help
Entry
SL103_14160       CDS       T04699                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
slc  Streptomyces lydicus 103
Pathway
slc00480  Glutathione metabolism
slc00590  Arachidonic acid metabolism
slc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:slc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    SL103_14160
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    SL103_14160
Enzymes [BR:slc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SL103_14160
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AOP47250
UniProt: A0A1D7VKH2
Position
complement(3285142..3285630)
Genome map
AA seq 162 aa AA seqDB search
MSLYDIPLRTLTGEPASLADYRGKALLVVNVASKCGLTPQYSGLERLQQRYGDRGFHVLG
FPSNQFAGQEPGTAEEIATFCSATYGVSFPLFEKTDVNGADRHPLYAELTGTEDADGAAG
DVQWNFEKFLIDADGRVAGRFRPRTEPEAEELVTAIEAALPA
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
gtgagcctgtacgacatcccgctgcgcaccctgaccggtgagcccgcctcgctcgccgac
taccggggcaaggccctgctggtggtgaatgtggcgtccaaatgcgggctgaccccgcag
tactccggcctggagcggctccagcagcgctacggggaccggggtttccacgtactgggc
ttccccagcaaccagttcgccggccaggagccgggcaccgccgaggagatcgccaccttc
tgctcggcgacgtacggcgtcagcttcccgctgttcgagaagaccgacgtcaacggcgcg
gaccggcatccgctgtacgcggagctgaccggtaccgaggacgccgacggggcggccggt
gacgtccagtggaacttcgagaagttcctgatcgacgccgacggccgggtcgccggccgc
ttccggccgcgcacggagccggaggccgaggaactggtcaccgccatcgaggcggcactg
ccggcctga

DBGET integrated database retrieval system